Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10892
Gene name
LocationContig_920:8105..9008
Strand-
Gene length (bp)903
Transcript length (bp)903
Coding sequence length (bp)903
Protein length (aa) 301

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00650 CRAL_TRIO CRAL/TRIO domain 1.1E-18 30 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33324|YKJ1_YEAST CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL091C PE=1 SV=2 28 129 5.0E-11
sp|Q06705|CSR1_YEAST Phosphatidylinositol transfer protein CSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSR1 PE=1 SV=1 33 130 3.0E-10
sp|Q757H2|CSR1_ASHGO Phosphatidylinositol transfer protein CSR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSR1 PE=3 SV=2 31 135 7.0E-10
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 28 132 2.0E-09
sp|Q16KN5|RETM_AEDAE Protein real-time OS=Aedes aegypti GN=retm PE=3 SV=1 29 129 9.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33324|YKJ1_YEAST CRAL-TRIO domain-containing protein YKL091C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL091C PE=1 SV=2 28 129 5.0E-11
sp|Q06705|CSR1_YEAST Phosphatidylinositol transfer protein CSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSR1 PE=1 SV=1 33 130 3.0E-10
sp|Q757H2|CSR1_ASHGO Phosphatidylinositol transfer protein CSR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSR1 PE=3 SV=2 31 135 7.0E-10
sp|P24280|SEC14_YEAST SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC14 PE=1 SV=3 28 132 2.0E-09
sp|Q16KN5|RETM_AEDAE Protein real-time OS=Aedes aegypti GN=retm PE=3 SV=1 29 129 9.0E-09
sp|Q03606|YN02_CAEEL CRAL-TRIO domain-containing protein T23G5.2 OS=Caenorhabditis elegans GN=T23G5.2 PE=3 SV=3 29 129 2.0E-08
sp|P45816|SEC14_YARLI SEC14 cytosolic factor OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC14 PE=3 SV=2 29 130 2.0E-08
sp|P46250|SEC14_CANAL SEC14 cytosolic factor OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC14 PE=2 SV=1 1 129 2.0E-08
sp|Q94A34|SFH12_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH12 OS=Arabidopsis thaliana GN=SFH12 PE=2 SV=1 38 129 3.0E-08
sp|P53989|SEC14_CANGA SEC14 cytosolic factor OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC14 PE=3 SV=1 28 161 3.0E-08
sp|Q7PWB1|RETM_ANOGA Protein real-time OS=Anopheles gambiae GN=retm PE=3 SV=4 29 129 4.0E-08
sp|P24859|SEC14_KLULA SEC14 cytosolic factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC14 PE=3 SV=2 27 132 6.0E-08
sp|Q9SI13|SFH10_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH10 OS=Arabidopsis thaliana GN=SFH10 PE=3 SV=1 38 129 8.0E-08
sp|O43304|S14L5_HUMAN SEC14-like protein 5 OS=Homo sapiens GN=SEC14L5 PE=2 SV=3 29 130 2.0E-07
sp|Q29JQ0|RETM_DROPS Protein real-time OS=Drosophila pseudoobscura pseudoobscura GN=retm PE=3 SV=1 37 129 2.0E-07
sp|Q75DK1|SEC14_ASHGO SEC14 cytosolic factor OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC14 PE=3 SV=2 38 130 2.0E-07
sp|Q92503|S14L1_HUMAN SEC14-like protein 1 OS=Homo sapiens GN=SEC14L1 PE=1 SV=2 18 130 3.0E-07
sp|Q9VMD6|RETM_DROME Protein real-time OS=Drosophila melanogaster GN=retm PE=1 SV=2 37 129 3.0E-07
sp|F4JVA9|SFH2_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH2 OS=Arabidopsis thaliana GN=SFH2 PE=2 SV=1 38 130 6.0E-07
sp|Q9UDX3|S14L4_HUMAN SEC14-like protein 4 OS=Homo sapiens GN=SEC14L4 PE=1 SV=1 29 141 6.0E-07
sp|F4IHJ0|SFH8_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH8 OS=Arabidopsis thaliana GN=SFH8 PE=2 SV=1 38 129 1.0E-06
sp|Q93ZE9|SFH3_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH3 OS=Arabidopsis thaliana GN=SFH3 PE=2 SV=1 38 129 2.0E-06
sp|Q0V9N0|S14L5_XENTR SEC14-like protein 5 OS=Xenopus tropicalis GN=sec14l1 PE=2 SV=1 29 130 2.0E-06
sp|Q9SIW3|SFH7_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH7 OS=Arabidopsis thaliana GN=SFH7 PE=2 SV=2 33 129 2.0E-06
sp|Q10137|SEC14_SCHPO Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec14 PE=3 SV=1 2 132 2.0E-06
sp|F4HP88|SFH4_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH4 OS=Arabidopsis thaliana GN=SFH4 PE=2 SV=1 38 129 3.0E-06
sp|F4JLE5|SFH1_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH1 OS=Arabidopsis thaliana GN=SFH1 PE=2 SV=1 38 146 3.0E-06
sp|F4JYJ3|SFH11_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH11 OS=Arabidopsis thaliana GN=SFH11 PE=3 SV=1 32 129 6.0E-06
sp|F4JVA6|SFH6_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH6 OS=Arabidopsis thaliana GN=SFH6 PE=2 SV=1 38 129 7.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6355 0.3803 0.0282 0.262 0.3559 0.0412 0.291 0.1283 0.3267 0.0048

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6505
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06266
Ophiocordyceps camponoti-rufipedis Ophun1|1709
Ophiocordyceps kimflemingae Ophio5|4670
Ophiocordyceps subramaniannii Hirsu2|10892 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10892
MLLSTAWFEYLDALILPLGRSNARPGNGGTPLSTVLFLCDVSGFTLKNFWAMKGHIRTLADAVTARYPETVGHVF
LVGAPSYFNTIWNWTKRFLDPVTASKFFILQPDQVKPTLETFIERRNIPVGLGGELEFEYGDPPALEPAISASLE
WRDGLDALPSGPLLLEETDDGAGLTCFTCGTAKGNPRRHEVFTMPKPSPFGAAAGEDKSRPAAGEAVNATVPIKL
LPIPDRDTDALPAVATPLAVNPRTPRDVPDSLTAARVTKAVRDATGMAGGGDNATTNGVGSKPMADCTVVCSAAA
*
Coding >Hirsu2|10892
ATGCTCCTGAGCACCGCGTGGTTCGAGTACCTAGACGCCCTGATCCTTCCCTTGGGCAGATCGAATGCCCGGCCC
GGGAACGGTGGCACGCCCTTGTCCACCGTTCTCTTCCTCTGCGATGTTTCCGGCTTCACACTCAAGAATTTTTGG
GCCATGAAAGGCCATATCCGCACTCTGGCTGATGCGGTCACGGCTCGATACCCCGAGACAGTCGGCCACGTCTTC
CTGGTCGGGGCCCCCTCCTACTTCAACACGATATGGAATTGGACCAAGCGCTTCCTCGATCCCGTCACCGCCTCC
AAGTTCTTCATCCTCCAGCCCGATCAGGTGAAGCCGACGCTGGAGACCTTCATCGAGCGACGCAACATCCCCGTC
GGCCTCGGCGGCGAGCTCGAGTTTGAGTATGGCGACCCTCCCGCGCTCGAGCCGGCCATCTCAGCCTCGCTGGAA
TGGCGCGACGGCCTCGACGCCCTGCCCAGCGGCCCGCTGCTGCTGGAGGAGACCGACGACGGCGCCGGCTTGACC
TGCTTCACCTGCGGCACCGCCAAGGGCAATCCCCGGAGGCACGAGGTCTTCACCATGCCCAAGCCGTCGCCTTTC
GGAGCTGCCGCCGGCGAGGACAAGAGCAGACCTGCAGCTGGAGAGGCTGTCAACGCGACAGTTCCTATCAAGCTG
TTACCTATCCCCGACCGCGATACTGATGCCCTGCCTGCTGTCGCGACCCCTCTTGCCGTCAACCCCCGGACGCCG
CGTGATGTTCCAGACTCACTCACTGCCGCGAGGGTCACCAAGGCCGTCCGGGACGCGACCGGGATGGCCGGGGGA
GGTGACAACGCCACAACCAACGGCGTTGGGAGCAAGCCGATGGCGGATTGCACTGTTGTTTGTTCCGCCGCCGCC
TGA
Transcript >Hirsu2|10892
ATGCTCCTGAGCACCGCGTGGTTCGAGTACCTAGACGCCCTGATCCTTCCCTTGGGCAGATCGAATGCCCGGCCC
GGGAACGGTGGCACGCCCTTGTCCACCGTTCTCTTCCTCTGCGATGTTTCCGGCTTCACACTCAAGAATTTTTGG
GCCATGAAAGGCCATATCCGCACTCTGGCTGATGCGGTCACGGCTCGATACCCCGAGACAGTCGGCCACGTCTTC
CTGGTCGGGGCCCCCTCCTACTTCAACACGATATGGAATTGGACCAAGCGCTTCCTCGATCCCGTCACCGCCTCC
AAGTTCTTCATCCTCCAGCCCGATCAGGTGAAGCCGACGCTGGAGACCTTCATCGAGCGACGCAACATCCCCGTC
GGCCTCGGCGGCGAGCTCGAGTTTGAGTATGGCGACCCTCCCGCGCTCGAGCCGGCCATCTCAGCCTCGCTGGAA
TGGCGCGACGGCCTCGACGCCCTGCCCAGCGGCCCGCTGCTGCTGGAGGAGACCGACGACGGCGCCGGCTTGACC
TGCTTCACCTGCGGCACCGCCAAGGGCAATCCCCGGAGGCACGAGGTCTTCACCATGCCCAAGCCGTCGCCTTTC
GGAGCTGCCGCCGGCGAGGACAAGAGCAGACCTGCAGCTGGAGAGGCTGTCAACGCGACAGTTCCTATCAAGCTG
TTACCTATCCCCGACCGCGATACTGATGCCCTGCCTGCTGTCGCGACCCCTCTTGCCGTCAACCCCCGGACGCCG
CGTGATGTTCCAGACTCACTCACTGCCGCGAGGGTCACCAAGGCCGTCCGGGACGCGACCGGGATGGCCGGGGGA
GGTGACAACGCCACAACCAACGGCGTTGGGAGCAAGCCGATGGCGGATTGCACTGTTGTTTGTTCCGCCGCCGCC
TGA
Gene >Hirsu2|10892
ATGCTCCTGAGCACCGCGTGGTTCGAGTACCTAGACGCCCTGATCCTTCCCTTGGGCAGATCGAATGCCCGGCCC
GGGAACGGTGGCACGCCCTTGTCCACCGTTCTCTTCCTCTGCGATGTTTCCGGCTTCACACTCAAGAATTTTTGG
GCCATGAAAGGCCATATCCGCACTCTGGCTGATGCGGTCACGGCTCGATACCCCGAGACAGTCGGCCACGTCTTC
CTGGTCGGGGCCCCCTCCTACTTCAACACGATATGGAATTGGACCAAGCGCTTCCTCGATCCCGTCACCGCCTCC
AAGTTCTTCATCCTCCAGCCCGATCAGGTGAAGCCGACGCTGGAGACCTTCATCGAGCGACGCAACATCCCCGTC
GGCCTCGGCGGCGAGCTCGAGTTTGAGTATGGCGACCCTCCCGCGCTCGAGCCGGCCATCTCAGCCTCGCTGGAA
TGGCGCGACGGCCTCGACGCCCTGCCCAGCGGCCCGCTGCTGCTGGAGGAGACCGACGACGGCGCCGGCTTGACC
TGCTTCACCTGCGGCACCGCCAAGGGCAATCCCCGGAGGCACGAGGTCTTCACCATGCCCAAGCCGTCGCCTTTC
GGAGCTGCCGCCGGCGAGGACAAGAGCAGACCTGCAGCTGGAGAGGCTGTCAACGCGACAGTTCCTATCAAGCTG
TTACCTATCCCCGACCGCGATACTGATGCCCTGCCTGCTGTCGCGACCCCTCTTGCCGTCAACCCCCGGACGCCG
CGTGATGTTCCAGACTCACTCACTGCCGCGAGGGTCACCAAGGCCGTCCGGGACGCGACCGGGATGGCCGGGGGA
GGTGACAACGCCACAACCAACGGCGTTGGGAGCAAGCCGATGGCGGATTGCACTGTTGTTTGTTCCGCCGCCGCC
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail