Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1089
Gene name
LocationContig_1229:3908..4730
Strand+
Gene length (bp)822
Transcript length (bp)678
Coding sequence length (bp)678
Protein length (aa) 226

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09802 Sec66 Preprotein translocase subunit Sec66 2.7E-77 7 188

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UUA4|SEC66_SCHPO Translocation protein sec66 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec66 PE=1 SV=1 9 183 3.0E-32
sp|P33754|SEC66_YEAST Translocation protein SEC66 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC66 PE=1 SV=1 12 180 5.0E-19

GO

GO Term Description Terminal node
GO:0031207 Sec62/Sec63 complex Yes
GO:0031204 posttranslational protein targeting to membrane, translocation Yes
GO:0044446 intracellular organelle part No
GO:0071702 organic substance transport No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0051234 establishment of localization No
GO:0044432 endoplasmic reticulum part No
GO:0042886 amide transport No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0015031 protein transport No
GO:0055085 transmembrane transport No
GO:0051179 localization No
GO:0071806 protein transmembrane transport No
GO:0046907 intracellular transport No
GO:0033036 macromolecule localization No
GO:0044425 membrane part No
GO:0008104 protein localization No
GO:0065002 intracellular protein transmembrane transport No
GO:0006810 transport No
GO:0051641 cellular localization No
GO:0008150 biological_process No
GO:0071705 nitrogen compound transport No
GO:0015833 peptide transport No
GO:0045184 establishment of protein localization No
GO:0006886 intracellular protein transport No
GO:0044422 organelle part No
GO:0098796 membrane protein complex No
GO:0051649 establishment of localization in cell No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 30 20

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1089
MFGVDWKGLALPFAYLLVLGGALMTFSTIYRKRKAAESANLAPWFGPNLQRNVYLSLLHMEPQDGQSKSPRVPDG
VLRAALLRRAVQDIERLIAIKSAKQACSTLLLRGSVGDDLWQRFQRAEKEMEEELRDVVTEANALAPNWGPTIFQ
SAHEIAANTKLRQRLDEIQAQTESEKQWWEKRRGQIQSDFMKELDDSEKSSTKATSEDDAVLIDTPGKSGKKGKK
*
Coding >Hirsu2|1089
ATGTTCGGAGTCGATTGGAAGGGCCTCGCCCTTCCCTTTGCATACCTGCTCGTCCTCGGCGGCGCCCTCATGACT
TTTTCGACCATCTACCGCAAGCGAAAAGCCGCCGAGAGCGCGAACCTGGCGCCCTGGTTCGGGCCCAACCTGCAG
CGCAACGTCTACCTGTCGCTGCTGCACATGGAGCCCCAGGACGGCCAGAGCAAGTCGCCGCGCGTGCCCGACGGC
GTCCTGCGCGCCGCGCTGCTGCGCCGCGCCGTCCAGGACATCGAGCGCCTCATCGCCATCAAGTCGGCCAAGCAG
GCCTGCAGCACCCTGCTGCTGCGCGGCAGCGTCGGCGACGACCTGTGGCAGCGCTTCCAGCGCGCCGAGAAGGAG
ATGGAGGAGGAGCTGCGAGACGTCGTCACCGAGGCCAACGCCCTGGCCCCCAACTGGGGCCCGACCATCTTCCAG
TCGGCGCACGAGATCGCCGCCAACACCAAGCTCCGCCAACGGCTCGACGAGATCCAGGCCCAGACCGAGTCGGAG
AAGCAGTGGTGGGAGAAGCGCCGGGGCCAGATCCAGAGCGACTTCATGAAGGAGCTCGACGACTCGGAAAAGAGC
TCGACCAAGGCCACGAGCGAGGACGACGCCGTCCTCATCGACACGCCCGGCAAGAGCGGCAAGAAAGGCAAGAAA
TAG
Transcript >Hirsu2|1089
ATGTTCGGAGTCGATTGGAAGGGCCTCGCCCTTCCCTTTGCATACCTGCTCGTCCTCGGCGGCGCCCTCATGACT
TTTTCGACCATCTACCGCAAGCGAAAAGCCGCCGAGAGCGCGAACCTGGCGCCCTGGTTCGGGCCCAACCTGCAG
CGCAACGTCTACCTGTCGCTGCTGCACATGGAGCCCCAGGACGGCCAGAGCAAGTCGCCGCGCGTGCCCGACGGC
GTCCTGCGCGCCGCGCTGCTGCGCCGCGCCGTCCAGGACATCGAGCGCCTCATCGCCATCAAGTCGGCCAAGCAG
GCCTGCAGCACCCTGCTGCTGCGCGGCAGCGTCGGCGACGACCTGTGGCAGCGCTTCCAGCGCGCCGAGAAGGAG
ATGGAGGAGGAGCTGCGAGACGTCGTCACCGAGGCCAACGCCCTGGCCCCCAACTGGGGCCCGACCATCTTCCAG
TCGGCGCACGAGATCGCCGCCAACACCAAGCTCCGCCAACGGCTCGACGAGATCCAGGCCCAGACCGAGTCGGAG
AAGCAGTGGTGGGAGAAGCGCCGGGGCCAGATCCAGAGCGACTTCATGAAGGAGCTCGACGACTCGGAAAAGAGC
TCGACCAAGGCCACGAGCGAGGACGACGCCGTCCTCATCGACACGCCCGGCAAGAGCGGCAAGAAAGGCAAGAAA
TAG
Gene >Hirsu2|1089
ATGTTCGGAGTCGATTGGAAGGGCCTCGCCCTTCCCTTTGCATACCTGCTCGTCCTCGGCGGCGCCCTCATGACT
TTTTCGACCATCTACCGCAAGCGAAAAGCCGGTAACGTCACCCAAACGGCCCCCCCCTCTCCGGCAGGAGGAGAA
AGGGCACCGTGCCACGACTGACGCGAAAACACGCTTCCAGCCGAGAGCGCGAACCTGGCGCCCTGGTTCGGGCCC
AACCTGCAGCGCAACGTCTACCTGTCGCTGCTGCACATGGAGCCCCAGGACGGCCAGAGCAAGTCGCCGCGCGTG
CCCGACGGCGTCCTGCGCGCCGCGCTGCTGCGCCGCGCCGTCCAGGACATCGAGCGCCTCATCGCCATCAAGTCG
GCCAAGCAGGCCTGCAGCACCCTGCTGCTGCGCGGCAGCGTCGGCGACGACCTGTGGCAGCGCTTCCAGCGCGCC
GAGAAGGAGATGGAGGAGGAGCTGCGAGACGTCGTCACCGAGGTAAGCCATTGCCTCTCTCCCCTCTCGGACCCA
GTTCGCTGACCAGAGGCCGCGTCGCAGGCCAACGCCCTGGCCCCCAACTGGGGCCCGACCATCTTCCAGTCGGCG
CACGAGATCGCCGCCAACACCAAGCTCCGCCAACGGCTCGACGAGATCCAGGCCCAGACCGAGTCGGAGAAGCAG
TGGTGGGAGAAGCGCCGGGGCCAGATCCAGAGCGACTTCATGAAGGAGCTCGACGACTCGGAAAAGAGCTCGACC
AAGGCCACGAGCGAGGACGACGCCGTCCTCATCGACACGCCCGGCAAGAGCGGCAAGAAAGGCAAGAAATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail