Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10888
Gene name
LocationContig_920:1677..2925
Strand-
Gene length (bp)1248
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03661 UPF0121 Uncharacterised protein family (UPF0121) 1.7E-29 18 256

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G0S6T0|POM33_CHATD Nucleoporin POM33 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=POM33 PE=3 SV=1 3 282 3.0E-122
sp|Q12164|POM33_YEAST Pore membrane protein of 33 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POM33 PE=1 SV=1 5 256 7.0E-37
sp|Q9Y7Z5|TTS1_SCHPO Tetra-spanning protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tts1 PE=1 SV=1 1 262 3.0E-31
sp|Q12144|PER33_YEAST Pore and endoplasmic reticulum protein of 33 kDa OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PER33 PE=1 SV=1 23 257 3.0E-07

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 24 43 19
2 56 73 17
3 106 128 22
4 180 199 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10888
MAPQPNSSMPLQERLLALAKTLQFAWFVGHLTLIMATFRYSFSWLRMNYYGSMAQFSYRTSFVAAAATYGIVVYK
TQRARAKTGARMSGGAVGLLADENVQYLLMALVWLLSPQYPLALLPYCVYSVFHVATYTRANLIPVFQPPPPAAE
GAAARPKVNSRLADQIGVFVKEYYDTSMSIVSGLELLLWFRVVLAAILFQRRSWILFGLYTAFLRARFSQSSHVQ
NSVSQLGARIDSLVGAQGTPPAARQIWANIKNGARQFHDATDMGKYVSSSGPAKKTS*
Coding >Hirsu2|10888
ATGGCTCCTCAACCCAACTCGAGCATGCCGCTTCAGGAGCGGCTTCTGGCCCTGGCCAAGACGCTGCAGTTCGCC
TGGTTTGTTGGCCACCTGACGCTCATCATGGCCACCTTTCGCTACAGCTTCTCCTGGCTGCGCATGAACTACTAC
GGCAGCATGGCCCAGTTCTCCTATCGCACCTCGTTCGTCGCCGCCGCCGCCACGTACGGCATCGTCGTCTACAAG
ACGCAGCGCGCCCGCGCAAAGACGGGGGCCAGGATGTCGGGCGGTGCCGTGGGCCTCCTTGCCGACGAAAACGTG
CAGTATCTTCTCATGGCCCTTGTCTGGCTCCTCTCTCCCCAGTACCCCCTGGCGCTGCTGCCTTACTGCGTCTAT
TCCGTCTTCCACGTCGCCACCTACACGCGCGCCAACCTGATTCCCGTCTTCCAGCCGCCGCCGCCCGCCGCCGAG
GGCGCCGCGGCTCGGCCCAAGGTGAACAGCCGGCTGGCGGACCAGATCGGCGTCTTCGTCAAGGAGTACTACGAC
ACGTCCATGTCCATCGTCTCGGGCCTGGAGCTCCTGCTGTGGTTCCGCGTCGTGCTCGCCGCCATCCTCTTCCAA
CGTAGGTCGTGGATCCTGTTTGGCCTCTACACGGCGTTCCTGCGCGCGCGCTTCTCCCAGAGCTCGCACGTCCAG
AACTCGGTATCGCAGCTCGGCGCCCGGATCGACTCGCTCGTCGGCGCGCAGGGCACGCCCCCGGCCGCCCGGCAG
ATCTGGGCCAACATCAAGAACGGGGCCAGGCAGTTCCACGACGCGACCGACATGGGCAAGTACGTCAGCAGCAGC
GGCCCCGCCAAGAAGACCTCGTAA
Transcript >Hirsu2|10888
ATGGCTCCTCAACCCAACTCGAGCATGCCGCTTCAGGAGCGGCTTCTGGCCCTGGCCAAGACGCTGCAGTTCGCC
TGGTTTGTTGGCCACCTGACGCTCATCATGGCCACCTTTCGCTACAGCTTCTCCTGGCTGCGCATGAACTACTAC
GGCAGCATGGCCCAGTTCTCCTATCGCACCTCGTTCGTCGCCGCCGCCGCCACGTACGGCATCGTCGTCTACAAG
ACGCAGCGCGCCCGCGCAAAGACGGGGGCCAGGATGTCGGGCGGTGCCGTGGGCCTCCTTGCCGACGAAAACGTG
CAGTATCTTCTCATGGCCCTTGTCTGGCTCCTCTCTCCCCAGTACCCCCTGGCGCTGCTGCCTTACTGCGTCTAT
TCCGTCTTCCACGTCGCCACCTACACGCGCGCCAACCTGATTCCCGTCTTCCAGCCGCCGCCGCCCGCCGCCGAG
GGCGCCGCGGCTCGGCCCAAGGTGAACAGCCGGCTGGCGGACCAGATCGGCGTCTTCGTCAAGGAGTACTACGAC
ACGTCCATGTCCATCGTCTCGGGCCTGGAGCTCCTGCTGTGGTTCCGCGTCGTGCTCGCCGCCATCCTCTTCCAA
CGTAGGTCGTGGATCCTGTTTGGCCTCTACACGGCGTTCCTGCGCGCGCGCTTCTCCCAGAGCTCGCACGTCCAG
AACTCGGTATCGCAGCTCGGCGCCCGGATCGACTCGCTCGTCGGCGCGCAGGGCACGCCCCCGGCCGCCCGGCAG
ATCTGGGCCAACATCAAGAACGGGGCCAGGCAGTTCCACGACGCGACCGACATGGGCAAGTACGTCAGCAGCAGC
GGCCCCGCCAAGAAGACCTCGTAA
Gene >Hirsu2|10888
ATGGCTCCTCAACCCAACTCGAGCATGCCGCTTCAGGAGCGGCTTCTGGCCCTGGCCAAGACGCTGCAGTGTACG
AGCTTGTCCCCCTTGCCTTGCGAGCCCGGCTTTTGCCTGTTGCTAACGTTGCCTCTGCCCCGCCTGCAGTCGCCT
GGTTTGTTGGGTGCGTTGCCGTCCATTCTGTTCCCGCTGTCGGGAGCTGCGCCGTCACCTTGGGTTGGGGCCGCG
GCTGCAGATACCGACGGACCTCTCGCCCTGCCCATGAGCTTGTGTCGCTGACGCTTCCCGGCTTCTAAACAGCCA
CCTGACGCTCATCATGGCCACCTTTCGCTACAGCTTCTCCTGGCTGCGCATGAACTACTACGGCAGCATGGCCCA
GTTCTCCTATCGCACCTCGTTCGTCGCCGCCGCCGCCACGTACGGCATCGTCGTCTACAAGACGCAGCGCGCCCG
CGCAAAGACGGGGGCCAGGATGTCGGGCGGTGCCGTGGGCCTCCTTGCCGACGAAAACGTGCAGTATCTTCGTAC
GTCAATCGCTCCTCCCGTTCCCTCCTTTGACCTCTCTCGCTCTCGGGGACGGCTTCGTCGCGGCAGAGGAACCTG
AGTCTCTCCCGCGATGGCTTCGTCCCGGCAGAGGAACCGGAGAGCAGTGTACCCCCCGCTGTCTGCCGCCCGCCG
TCACTGACTCGACGCCCTCGTTCCTCACGCGCAGTCATGGCCCTTGTCTGGCTCCTCTCTCCCCAGTACCCCCTG
GCGCTGCTGCCTTACTGCGTCTATTCCGTCTTCCACGTCGCCACCTACACGCGCGCCAACCTGATTCCCGTCTTC
CAGCCGCCGCCGCCCGCCGCCGAGGGCGCCGCGGCTCGGCCCAAGGTGAACAGCCGGCTGGCGGACCAGATCGGC
GTCTTCGTCAAGGAGTACTACGACACGTCCATGTCCATCGTCTCGGGCCTGGAGCTCCTGCTGTGGTTCCGCGTC
GTGCTCGCCGCCATCCTCTTCCAACGTAGGTCGTGGATCCTGTTTGGCCTCTACACGGCGTTCCTGCGCGCGCGC
TTCTCCCAGAGCTCGCACGTCCAGAACTCGGTATCGCAGCTCGGCGCCCGGATCGACTCGCTCGTCGGCGCGCAG
GGCACGCCCCCGGCCGCCCGGCAGATCTGGGCCAACATCAAGAACGGGGCCAGGCAGTTCCACGACGCGACCGAC
ATGGGCAAGTACGTCAGCAGCAGCGGCCCCGCCAAGAAGACCTCGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail