Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10878
Gene name
LocationContig_92:12437..13812
Strand+
Gene length (bp)1375
Transcript length (bp)1236
Coding sequence length (bp)1236
Protein length (aa) 412

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 6.9E-33 80 385

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CS83|CARP2_CANAX Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 43 382 5.0E-15
sp|C4YMJ3|CARP2_CANAW Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 43 382 6.0E-15
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 62 246 8.0E-15
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 73 385 1.0E-14
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 62 246 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CS83|CARP2_CANAX Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 43 382 5.0E-15
sp|C4YMJ3|CARP2_CANAW Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 43 382 6.0E-15
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 62 246 8.0E-15
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 73 385 1.0E-14
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 62 246 1.0E-14
sp|P0DJ06|CARP2_CANAL Candidapepsin-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP2 PE=1 SV=1 43 382 2.0E-14
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 57 371 4.0E-14
sp|Q59VH7|CARP7_CANAL Candidapepsin-7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP7 PE=1 SV=1 73 385 4.0E-14
sp|Q59SU1|CARP9_CANAL Candidapepsin-9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP9 PE=1 SV=1 123 385 6.0E-14
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 57 386 6.0E-14
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 73 373 8.0E-14
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 21 386 9.0E-14
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 57 371 2.0E-13
sp|O42779|CARP9_CANAX Candidapepsin-9 OS=Candida albicans GN=SAP9 PE=3 SV=1 123 385 2.0E-13
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 24 386 2.0E-13
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 21 386 2.0E-13
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 21 386 3.0E-13
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 73 373 3.0E-13
sp|P32950|CARP2_CANPA Candidapepsin-2 OS=Candida parapsilosis GN=SAPP2 PE=1 SV=1 60 384 9.0E-13
sp|C4YNQ5|CARP3_CANAW Candidapepsin-3 OS=Candida albicans (strain WO-1) GN=SAP3 PE=1 SV=1 82 371 1.0E-12
sp|C4YSF6|CARP1_CANAW Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 57 371 1.0E-12
sp|P0CY29|CARP3_CANAL Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP3 PE=1 SV=1 82 371 1.0E-12
sp|P0CY28|CARP3_CANAX Candidapepsin-3 OS=Candida albicans GN=SAP3 PE=1 SV=1 82 371 1.0E-12
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 54 385 2.0E-12
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 70 358 5.0E-12
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 80 391 9.0E-12
sp|Q00663|CARP_CANTR Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 8 270 2.0E-11
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 70 359 3.0E-11
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 73 373 4.0E-11
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 73 373 5.0E-11
sp|Q5A651|CAR10_CANAL Candidapepsin-10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP10 PE=1 SV=1 62 243 7.0E-11
sp|O42630|CARP_ASPFU Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 66 331 1.0E-10
sp|P53379|MKC7_YEAST Aspartic proteinase MKC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKC7 PE=1 SV=2 67 384 2.0E-10
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 80 391 7.0E-10
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 70 307 2.0E-09
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 123 385 2.0E-09
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 90 373 2.0E-09
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 80 384 4.0E-09
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 67 376 4.0E-09
sp|P40583|YPS6_YEAST Aspartic proteinase yapsin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS6 PE=1 SV=1 62 376 4.0E-09
sp|P32951|CARP1_CANPA Candidapepsin-1 OS=Candida parapsilosis GN=SAPP1 PE=1 SV=1 61 384 8.0E-09
sp|Q8SQ41|PEPB_CANLF Pepsin B OS=Canis lupus familiaris GN=PGB PE=1 SV=1 77 384 9.0E-09
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 77 384 1.0E-08
sp|Q9N2D4|PEPA_CALJA Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 65 376 2.0E-08
sp|P43096|CARP7_CANAX Candidapepsin-7 OS=Candida albicans GN=SAP7 PE=3 SV=1 73 385 3.0E-08
sp|P27822|PEPA3_RABIT Pepsin-3 OS=Oryctolagus cuniculus PE=2 SV=1 80 375 1.0E-07
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 77 247 2.0E-07
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 80 397 2.0E-07
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 80 383 2.0E-07
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 67 391 3.0E-07
sp|P03954|PEPA1_MACFU Pepsin A-1 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=2 65 388 3.0E-07
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 80 376 4.0E-07
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 80 374 4.0E-07
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 54 388 4.0E-07
sp|P27821|PEPA2_RABIT Pepsin II-2/3 OS=Oryctolagus cuniculus PE=2 SV=1 80 375 5.0E-07
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 80 376 5.0E-07
sp|P28712|PEPA1_RABIT Pepsin II-1 OS=Oryctolagus cuniculus PE=2 SV=1 80 375 5.0E-07
sp|D4DGR1|Y6366_TRIVH Probable aspartic-type endopeptidase TRV_06366 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06366 PE=3 SV=1 83 344 5.0E-07
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 80 376 6.0E-07
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 80 376 6.0E-07
sp|D4AT39|Y7403_ARTBC Probable aspartic-type endopeptidase ARB_07403 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07403 PE=3 SV=2 83 344 8.0E-07
sp|P28713|PEPA4_RABIT Pepsin II-4 OS=Oryctolagus cuniculus PE=2 SV=1 80 375 8.0E-07
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 83 373 9.0E-07
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 65 376 1.0E-06
sp|P16476|PEPE_CHICK Embryonic pepsinogen OS=Gallus gallus PE=2 SV=1 61 335 1.0E-06
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 69 383 2.0E-06
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 83 243 3.0E-06
sp|Q689Z7|PEPC_MONDO Gastricsin OS=Monodelphis domestica GN=PGC PE=2 SV=1 80 384 3.0E-06
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 25 243 5.0E-06
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 80 243 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10878
MRLHSLVVTLGLAGPLFAHPLDQPQGPEHEATTKSRILQLPIVVSDPREEDVGNRNEGSVDRRGVIDRPLIEENS
MSGVFVELTVGNPGQKVKVHLGTGSSKLFVISAPDDPDQSLSQPELFFNASKSQTIKGTGKSDSVSYADGSAADW
EVYEDDISLGSTSVGRVPFGVTPRNLTTGSKYGIWGMNMAKDNKLFRLMAEKGLISSRAFSLDVGNASTHAGFVT
FGGLDTKKFSGPLVKLPLVTNLNPIVEGQNKPESSPTTRYAVILDKISMSENGQKKGIFDRKDRAEDVQVILDSG
SQYNVLPTFLFDEFVRQFPDARKSTYGRFSVFPQHHGSPSFLVVDCALKNSTATIDFTFGEATIRVPFSEFIVQR
QFYACELGVMELPKFSTSHQTLLKPRAQRLAVGENS*
Coding >Hirsu2|10878
ATGCGTCTCCATTCGCTTGTCGTTACTCTTGGGCTGGCTGGGCCGCTCTTCGCCCATCCTCTCGATCAGCCACAG
GGCCCAGAGCATGAAGCTACTACGAAGTCCCGGATCCTACAGCTGCCCATCGTTGTTTCCGATCCCCGGGAAGAG
GATGTGGGGAATCGAAATGAAGGCTCTGTAGATCGTCGTGGAGTGATCGATAGACCTCTGATTGAAGAAAATAGT
ATGAGTGGCGTATTCGTTGAGCTCACTGTGGGCAATCCCGGCCAGAAAGTCAAGGTCCATCTAGGTACTGGATCT
TCTAAGCTGTTTGTTATCAGCGCGCCGGATGACCCCGATCAGTCGTTGAGCCAACCCGAGCTCTTCTTCAATGCG
AGCAAAAGTCAAACCATCAAAGGAACTGGGAAGTCCGACTCGGTATCATATGCCGACGGCTCCGCTGCGGACTGG
GAAGTTTATGAGGATGATATATCGCTTGGATCGACCTCGGTGGGACGCGTCCCCTTCGGCGTTACGCCCCGGAAC
TTGACGACTGGCTCGAAGTACGGCATCTGGGGCATGAACATGGCGAAGGACAACAAGCTCTTCCGCCTTATGGCC
GAGAAGGGCTTGATTAGTAGTCGGGCGTTCAGTCTCGATGTAGGGAACGCCAGTACGCACGCCGGCTTCGTTACA
TTCGGCGGCCTCGATACAAAGAAGTTTAGCGGACCGCTGGTAAAGTTGCCTTTGGTCACGAACCTCAACCCGATA
GTCGAAGGCCAGAACAAACCCGAGTCCAGCCCCACTACGCGATACGCAGTCATCCTCGACAAGATCAGCATGTCC
GAGAACGGACAAAAGAAAGGCATCTTCGACAGAAAAGACCGTGCCGAGGATGTTCAAGTCATATTGGACTCTGGT
TCTCAGTACAACGTCCTGCCTACGTTTTTGTTTGACGAGTTCGTTCGTCAATTCCCAGACGCCCGCAAGAGCACA
TACGGTAGATTTTCAGTCTTTCCACAGCACCATGGCTCTCCGTCCTTCCTGGTAGTTGATTGTGCTCTCAAAAAT
TCCACTGCCACCATCGACTTCACATTTGGCGAGGCCACTATTCGGGTCCCGTTTTCCGAGTTTATCGTCCAGAGG
CAGTTTTACGCTTGTGAGCTGGGCGTTATGGAATTACCCAAGTTCAGTACGTCTCACCAGACCCTTCTCAAGCCA
CGTGCTCAACGCCTGGCTGTCGGTGAGAACAGTTAA
Transcript >Hirsu2|10878
ATGCGTCTCCATTCGCTTGTCGTTACTCTTGGGCTGGCTGGGCCGCTCTTCGCCCATCCTCTCGATCAGCCACAG
GGCCCAGAGCATGAAGCTACTACGAAGTCCCGGATCCTACAGCTGCCCATCGTTGTTTCCGATCCCCGGGAAGAG
GATGTGGGGAATCGAAATGAAGGCTCTGTAGATCGTCGTGGAGTGATCGATAGACCTCTGATTGAAGAAAATAGT
ATGAGTGGCGTATTCGTTGAGCTCACTGTGGGCAATCCCGGCCAGAAAGTCAAGGTCCATCTAGGTACTGGATCT
TCTAAGCTGTTTGTTATCAGCGCGCCGGATGACCCCGATCAGTCGTTGAGCCAACCCGAGCTCTTCTTCAATGCG
AGCAAAAGTCAAACCATCAAAGGAACTGGGAAGTCCGACTCGGTATCATATGCCGACGGCTCCGCTGCGGACTGG
GAAGTTTATGAGGATGATATATCGCTTGGATCGACCTCGGTGGGACGCGTCCCCTTCGGCGTTACGCCCCGGAAC
TTGACGACTGGCTCGAAGTACGGCATCTGGGGCATGAACATGGCGAAGGACAACAAGCTCTTCCGCCTTATGGCC
GAGAAGGGCTTGATTAGTAGTCGGGCGTTCAGTCTCGATGTAGGGAACGCCAGTACGCACGCCGGCTTCGTTACA
TTCGGCGGCCTCGATACAAAGAAGTTTAGCGGACCGCTGGTAAAGTTGCCTTTGGTCACGAACCTCAACCCGATA
GTCGAAGGCCAGAACAAACCCGAGTCCAGCCCCACTACGCGATACGCAGTCATCCTCGACAAGATCAGCATGTCC
GAGAACGGACAAAAGAAAGGCATCTTCGACAGAAAAGACCGTGCCGAGGATGTTCAAGTCATATTGGACTCTGGT
TCTCAGTACAACGTCCTGCCTACGTTTTTGTTTGACGAGTTCGTTCGTCAATTCCCAGACGCCCGCAAGAGCACA
TACGGTAGATTTTCAGTCTTTCCACAGCACCATGGCTCTCCGTCCTTCCTGGTAGTTGATTGTGCTCTCAAAAAT
TCCACTGCCACCATCGACTTCACATTTGGCGAGGCCACTATTCGGGTCCCGTTTTCCGAGTTTATCGTCCAGAGG
CAGTTTTACGCTTGTGAGCTGGGCGTTATGGAATTACCCAAGTTCAGTACGTCTCACCAGACCCTTCTCAAGCCA
CGTGCTCAACGCCTGGCTGTCGGTGAGAACAGTTAA
Gene >Hirsu2|10878
ATGCGTCTCCATTCGCTTGTCGTTACTCTTGGGCTGGCTGGGCCGCTCTTCGCCCATCCTCTCGATCAGCCACAG
GGCCCAGAGCATGAAGCTACTACGAAGTCCCGGATCCTACAGCTGCCCATCGTTGTTTCCGATCCCCGGGAAGAG
GATGTGGGGAATCGAAATGAAGGCTCTGTAGATCGTCGTGGAGTGATCGATAGACCTCTGATTGAAGAAAATAGT
ATGAGTGGCGTATTCGTTGAGCTCACTGTGGGCAATCCCGGCCAGAAAGTCAAGGTCCATCTAGGTACTGGATCT
TCTAAGCTGTTTGTTATCAGCGCGCCGGATGACCCCGATCAGTCGTTGAGCCAACCCGAGCTCTTCTTCAATGCG
AGCAAAAGTCAAACCATCAAAGGAACTGGGAAGTCCGACTCGGTATCATATGCCGACGGCTCCGCTGCGGACTGG
GAAGTTTATGAGGATGATATATCGCTTGGATGTAAGTCTTTTGGACCTGTCGTCGATGGTCGTTTGATGTCCCAG
CTGGCTGATGCATGCGTCCTCGTGAAGCGACCTCGGTGGGACGCGTCCCCTTCGGCGTTACGCCCCGGAACTTGA
CGACTGGCTCGAAGTACGGCATCTGGGGCATGAACATGGCGAAGGACAACAAGCTCTTCCGCCTTATGGCCGAGA
AGGGCTTGATTAGTAGTCGGGCGTTCAGTCTCGATGTAGGGAACGCCAGTACGCACGCCGGCTTCGTTACATTCG
GCGGCCTCGATACAAAGAAGTTTAGCGGACCGCTGGTAAAGTTGCCTTTGGTCACGAACCTCAACCCGATAGTCG
AAGGCCAGAACAAACCCGAGTCCAGCCCCACTACGCGGTCAGTCAGAGCCCCTATTCTGGGCAGCAAAGGGAAAA
GCTAATGCGAGGACGCCGGTCGGAGTTTAGATACGCAGTCATCCTCGACAAGATCAGCATGTCCGAGAACGGACA
AAAGAAAGGCATCTTCGACAGAAAAGACCGTGCCGAGGATGTTCAAGTCATATTGGACTCTGGTTCTCAGTACAA
CGTCCTGCCTACGTTTTTGTTTGACGAGTTCGTTCGTCAATTCCCAGACGCCCGCAAGAGCACATACGGTAGATT
TTCAGTCTTTCCACAGCACCATGGCTCTCCGTCCTTCCTGGTAGTTGATTGTGCTCTCAAAAATTCCACTGCCAC
CATCGACTTCACATTTGGCGAGGCCACTATTCGGGTCCCGTTTTCCGAGTTTATCGTCCAGAGGCAGTTTTACGC
TTGTGAGCTGGGCGTTATGGAATTACCCAAGTTCAGTACGTCTCACCAGACCCTTCTCAAGCCACGTGCTCAACG
CCTGGCTGTCGGTGAGAACAGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail