Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10875
Gene name
LocationContig_919:8247..10123
Strand-
Gene length (bp)1876
Transcript length (bp)1659
Coding sequence length (bp)1659
Protein length (aa) 553

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10281 Ish1 Putative nuclear envelope organisation protein 3.5E-06 30 65
PF10281 Ish1 Putative nuclear envelope organisation protein 1.3E-12 131 165
PF10281 Ish1 Putative nuclear envelope organisation protein 4.8E-14 186 221
PF10281 Ish1 Putative nuclear envelope organisation protein 1.1E-08 253 287
PF10281 Ish1 Putative nuclear envelope organisation protein 2.5E-10 336 369
PF10281 Ish1 Putative nuclear envelope organisation protein 6.3E-11 454 488

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03104|MSC1_YEAST Meiotic sister chromatid recombination protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSC1 PE=1 SV=1 8 500 2.0E-25
sp|Q9Y7X6|ISH1_SCHPO Stress response protein ish1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ish1 PE=1 SV=1 74 470 1.0E-19
sp|Q9Y7X6|ISH1_SCHPO Stress response protein ish1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ish1 PE=1 SV=1 7 489 7.0E-18
sp|O94559|YF65_SCHPO Uncharacterized protein C23C4.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C4.05c PE=3 SV=1 132 477 3.0E-14
sp|O94559|YF65_SCHPO Uncharacterized protein C23C4.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C4.05c PE=3 SV=1 73 279 2.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10875
MRHVAALLTAAVAASGVVASSWFPGSKAAYNKWHQSELERWLSDHNVPYPQKADRTALEDLVSKHWNDLVLEPYK
QWDTAQLSSFVRNKGKEAGAEADEAKDNLVAQVKANWYETEDNARNAWASVKEWIFDTWTESQLKSFCDRHGIPV
PQPRHRDTLLQKVRSGYEAAAKKASETTAYPGNWLFETWSESDLKTWLDTHGFPAPQPSSRDKLIASVRRNSRLA
YLQAQQQVASASASAHAAYSTLTDMIIDAWNESQLKEFCDKNGIPVPQGTRVNELRALVRKHRAEILGDTISASA
ASAFGAATSKAGNEFAKASDSASLAAQDAFNQAVGTWSESRLKAYLDARGVPVPQQSSADELRALVRKHSHKAWV
GSSAWTFDDFSLENLKEYLSEHGNDVARTAAEKKDASRDELARAAQSAYSSASTAGGAEYASMTKAIASATAAVK
KDTFKSWSSTDLKAYLDSYGIPVPHGSKVEELKALARKQSTYFKYGVSSPSETIFAKLGETAREGWNWVAHQLNL
GSRAAQQKAAEAKASARSKTEQIKEEL*
Coding >Hirsu2|10875
ATGAGGCACGTAGCCGCGCTCCTGACGGCTGCCGTGGCGGCCTCTGGCGTCGTCGCCAGCAGCTGGTTTCCGGGC
TCCAAGGCTGCCTACAACAAATGGCACCAGTCGGAACTCGAGCGCTGGCTGTCCGATCACAACGTCCCCTATCCC
CAGAAGGCTGATCGTACTGCTCTGGAAGACCTGGTCAGCAAGCACTGGAATGACCTAGTGCTCGAGCCCTACAAG
CAGTGGGATACAGCGCAGCTGAGCAGCTTCGTCCGCAACAAGGGCAAGGAGGCCGGTGCAGAGGCCGACGAGGCC
AAGGATAACCTCGTTGCTCAGGTCAAAGCCAACTGGTACGAGACGGAGGACAACGCTCGCAACGCCTGGGCTAGC
GTCAAGGAGTGGATTTTTGACACCTGGACCGAGAGCCAGCTCAAGTCCTTCTGTGACAGACATGGCATCCCAGTC
CCCCAACCACGCCATCGCGACACCCTCTTGCAAAAGGTTCGCTCTGGCTACGAAGCCGCGGCCAAGAAGGCGAGC
GAGACCACCGCCTACCCGGGCAACTGGCTTTTCGAGACCTGGTCTGAGTCTGACCTGAAGACTTGGCTCGACACA
CACGGATTCCCTGCGCCTCAACCCTCAAGCCGTGACAAACTCATTGCGTCGGTTCGACGTAACTCTCGACTGGCC
TATCTCCAGGCCCAACAACAAGTGGCAAGCGCCAGCGCCAGCGCCCACGCGGCTTATTCCACGCTTACGGACATG
ATCATTGACGCTTGGAACGAATCGCAGCTCAAAGAGTTCTGCGACAAGAATGGCATACCCGTCCCTCAAGGCACG
AGGGTCAACGAGCTTCGTGCCCTAGTTCGCAAGCACCGCGCCGAGATACTTGGCGACACGATTAGTGCCAGCGCG
GCGTCGGCATTCGGGGCTGCCACTTCCAAGGCCGGCAACGAATTCGCCAAGGCGTCAGACAGCGCTTCGCTGGCG
GCTCAGGATGCCTTCAACCAGGCCGTGGGAACATGGTCCGAGAGCCGTCTCAAGGCTTACCTGGATGCCCGAGGG
GTCCCTGTTCCCCAGCAGTCTTCGGCGGATGAACTTCGAGCGCTCGTTCGTAAGCATTCGCACAAGGCCTGGGTG
GGGTCGAGTGCCTGGACATTTGACGACTTCTCCCTCGAGAACTTGAAAGAGTACCTCTCCGAGCACGGTAATGAT
GTCGCCAGAACCGCGGCCGAGAAGAAGGACGCTTCCCGGGACGAGCTCGCCCGCGCCGCACAGTCGGCTTATTCG
TCGGCCTCGACTGCAGGTGGCGCCGAGTACGCTTCCATGACCAAGGCCATCGCGTCGGCCACGGCAGCTGTCAAG
AAAGACACTTTCAAGAGCTGGTCCAGCACTGATCTCAAGGCTTATCTCGACAGCTACGGCATTCCCGTTCCACAC
GGGTCCAAAGTCGAAGAATTGAAAGCCTTGGCTCGCAAGCAATCGACGTATTTCAAGTACGGCGTATCATCACCG
AGCGAGACCATCTTCGCTAAGCTCGGGGAAACGGCGAGGGAGGGTTGGAACTGGGTCGCCCATCAGCTAAATCTG
GGAAGTCGAGCCGCTCAACAGAAAGCGGCAGAAGCTAAAGCATCGGCCAGAAGCAAGACGGAGCAAATCAAGGAA
GAACTATAG
Transcript >Hirsu2|10875
ATGAGGCACGTAGCCGCGCTCCTGACGGCTGCCGTGGCGGCCTCTGGCGTCGTCGCCAGCAGCTGGTTTCCGGGC
TCCAAGGCTGCCTACAACAAATGGCACCAGTCGGAACTCGAGCGCTGGCTGTCCGATCACAACGTCCCCTATCCC
CAGAAGGCTGATCGTACTGCTCTGGAAGACCTGGTCAGCAAGCACTGGAATGACCTAGTGCTCGAGCCCTACAAG
CAGTGGGATACAGCGCAGCTGAGCAGCTTCGTCCGCAACAAGGGCAAGGAGGCCGGTGCAGAGGCCGACGAGGCC
AAGGATAACCTCGTTGCTCAGGTCAAAGCCAACTGGTACGAGACGGAGGACAACGCTCGCAACGCCTGGGCTAGC
GTCAAGGAGTGGATTTTTGACACCTGGACCGAGAGCCAGCTCAAGTCCTTCTGTGACAGACATGGCATCCCAGTC
CCCCAACCACGCCATCGCGACACCCTCTTGCAAAAGGTTCGCTCTGGCTACGAAGCCGCGGCCAAGAAGGCGAGC
GAGACCACCGCCTACCCGGGCAACTGGCTTTTCGAGACCTGGTCTGAGTCTGACCTGAAGACTTGGCTCGACACA
CACGGATTCCCTGCGCCTCAACCCTCAAGCCGTGACAAACTCATTGCGTCGGTTCGACGTAACTCTCGACTGGCC
TATCTCCAGGCCCAACAACAAGTGGCAAGCGCCAGCGCCAGCGCCCACGCGGCTTATTCCACGCTTACGGACATG
ATCATTGACGCTTGGAACGAATCGCAGCTCAAAGAGTTCTGCGACAAGAATGGCATACCCGTCCCTCAAGGCACG
AGGGTCAACGAGCTTCGTGCCCTAGTTCGCAAGCACCGCGCCGAGATACTTGGCGACACGATTAGTGCCAGCGCG
GCGTCGGCATTCGGGGCTGCCACTTCCAAGGCCGGCAACGAATTCGCCAAGGCGTCAGACAGCGCTTCGCTGGCG
GCTCAGGATGCCTTCAACCAGGCCGTGGGAACATGGTCCGAGAGCCGTCTCAAGGCTTACCTGGATGCCCGAGGG
GTCCCTGTTCCCCAGCAGTCTTCGGCGGATGAACTTCGAGCGCTCGTTCGTAAGCATTCGCACAAGGCCTGGGTG
GGGTCGAGTGCCTGGACATTTGACGACTTCTCCCTCGAGAACTTGAAAGAGTACCTCTCCGAGCACGGTAATGAT
GTCGCCAGAACCGCGGCCGAGAAGAAGGACGCTTCCCGGGACGAGCTCGCCCGCGCCGCACAGTCGGCTTATTCG
TCGGCCTCGACTGCAGGTGGCGCCGAGTACGCTTCCATGACCAAGGCCATCGCGTCGGCCACGGCAGCTGTCAAG
AAAGACACTTTCAAGAGCTGGTCCAGCACTGATCTCAAGGCTTATCTCGACAGCTACGGCATTCCCGTTCCACAC
GGGTCCAAAGTCGAAGAATTGAAAGCCTTGGCTCGCAAGCAATCGACGTATTTCAAGTACGGCGTATCATCACCG
AGCGAGACCATCTTCGCTAAGCTCGGGGAAACGGCGAGGGAGGGTTGGAACTGGGTCGCCCATCAGCTAAATCTG
GGAAGTCGAGCCGCTCAACAGAAAGCGGCAGAAGCTAAAGCATCGGCCAGAAGCAAGACGGAGCAAATCAAGGAA
GAACTATAG
Gene >Hirsu2|10875
ATGAGGCACGTAGCCGCGCTCCTGACGGCTGCCGTGGCGGCCTCTGGCGTCGTCGCCAGCAGCTGGTTTCCGGGC
TCCAAGGCTGGTACGCGCGACTGAGGCCCCCTTGTTTCAGGACCCTACTCTGCTTGCCCAACTTCCTCCTCCTCT
CTGCCGGCTTTCTCAGCCTATCCAGCTGACGCGAGGCCTGTCCAGCCTACAACAAATGGCACCAGTCGGAACTCG
AGCGCTGGCTGTCCGATCACAACGTCCCCTATCCCCAGAAGGCTGATCGTACTGCTCTGGAAGACCTGGTCAGCA
AGCACTGGAATGACCTAGTGCTCGAGCCCTACAAGCAGTGGGATACAGCGCAGCTGAGCAGCTTCGTCCGCAACA
AGGGCAAGGAGGCCGGTGCAGAGGCCGACGAGGCCAAGGATAACCTCGTTGCTCAGGTCAAAGCCAACTGGTACG
AGACGGAGGACAACGCTCGCAACGCCTGGGCTAGCGTCAAGGAGTGGATTTTTGACACCTGGACCGAGAGCCAGC
TCAAGTCCTTCTGTGACAGACATGGCATCCCAGGTATGCACTGCCCCTCGCTCCTTTCGTCCGGGTTCCTCCGGC
GTCACTCGGTCACATGTATATCCGTGCATGGTTGTCCGCTGATCGCCGGCGTCTGCCTTCTACAGTCCCCCAACC
ACGCCATCGCGACACCCTCTTGCAAAAGGTTCGCTCTGGCTACGAAGCCGCGGCCAAGAAGGCGAGCGAGACCAC
CGCCTACCCGGGCAACTGGCTTTTCGAGACCTGGTCTGAGTCTGACCTGAAGACTTGGCTCGACACACACGGATT
CCCTGCGCCTCAACCCTCAAGCCGTGACAAACTCATTGCGTCGGTTCGACGTAACTCTCGACTGGCCTATCTCCA
GGCCCAACAACAAGTGGCAAGCGCCAGCGCCAGCGCCCACGCGGCTTATTCCACGCTTACGGACATGATCATTGA
CGCTTGGAACGAATCGCAGCTCAAAGAGTTCTGCGACAAGAATGGCATACCCGTCCCTCAAGGCACGAGGGTCAA
CGAGCTTCGTGCCCTAGTTCGCAAGCACCGCGCCGAGATACTTGGCGACACGATTAGTGCCAGCGCGGCGTCGGC
ATTCGGGGCTGCCACTTCCAAGGCCGGCAACGAATTCGCCAAGGCGTCAGACAGCGCTTCGCTGGCGGCTCAGGA
TGCCTTCAACCAGGCCGTGGGAACATGGTCCGAGAGCCGTCTCAAGGCTTACCTGGATGCCCGAGGGGTCCCTGT
TCCCCAGCAGTCTTCGGCGGATGAACTTCGAGCGCTCGTTCGTAAGCATTCGCACAAGGCCTGGGTGGGGTCGAG
TGCCTGGACATTTGACGACTTCTCCCTCGAGAACTTGAAAGAGTACCTCTCCGAGCACGGTAATGATGTCGCCAG
AACCGCGGCCGAGAAGAAGGACGCTTCCCGGGACGAGCTCGCCCGCGCCGCACAGTCGGCTTATTCGTCGGCCTC
GACTGCAGGTGGCGCCGAGTACGCTTCCATGACCAAGGCCATCGCGTCGGCCACGGCAGCTGTCAAGAAAGACAC
TTTCAAGAGCTGGTCCAGCACTGATCTCAAGGCTTATCTCGACAGCTACGGCATTCCCGTTCCACACGGGTCCAA
AGTCGAAGAATTGAAAGCCTTGGCTCGCAAGCAATCGACGTATTTCAAGTACGGCGTATCATCACCGAGCGAGAC
CATCTTCGCTAAGCTCGGGGAAACGGCGAGGGAGGGTTGGAACTGGGTCGCCCATCAGCTAAATCTGGGAAGTCG
AGCCGCTCAACAGAAAGCGGCAGAAGCTAAAGCATCGGCCAGAAGCAAGACGGAGCAAATCAAGGAAGAACTATA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail