Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10869
Gene name
LocationContig_918:1169..3419
Strand+
Gene length (bp)2250
Transcript length (bp)1320
Coding sequence length (bp)1320
Protein length (aa) 440

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 2.1E-38 80 248
PF00271 Helicase_C Helicase conserved C-terminal domain 5.0E-24 286 394
PF04851 ResIII Type III restriction enzyme, res subunit 8.7E-08 96 244

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RBS3|SUB2_MAGO7 ATP-dependent RNA helicase SUB2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SUB2 PE=3 SV=1 1 439 0.0E+00
sp|Q2H4D0|SUB2_CHAGB ATP-dependent RNA helicase SUB2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SUB2 PE=3 SV=1 1 439 0.0E+00
sp|Q1DI07|SUB2_COCIM ATP-dependent RNA helicase SUB2 OS=Coccidioides immitis (strain RS) GN=SUB2 PE=3 SV=1 1 438 0.0E+00
sp|A1DL85|SUB2_NEOFI ATP-dependent RNA helicase sub2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sub2 PE=3 SV=1 1 438 0.0E+00
sp|A1CMQ7|SUB2_ASPCL ATP-dependent RNA helicase sub2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sub2 PE=3 SV=1 1 438 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RBS3|SUB2_MAGO7 ATP-dependent RNA helicase SUB2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SUB2 PE=3 SV=1 1 439 0.0E+00
sp|Q2H4D0|SUB2_CHAGB ATP-dependent RNA helicase SUB2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SUB2 PE=3 SV=1 1 439 0.0E+00
sp|Q1DI07|SUB2_COCIM ATP-dependent RNA helicase SUB2 OS=Coccidioides immitis (strain RS) GN=SUB2 PE=3 SV=1 1 438 0.0E+00
sp|A1DL85|SUB2_NEOFI ATP-dependent RNA helicase sub2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sub2 PE=3 SV=1 1 438 0.0E+00
sp|A1CMQ7|SUB2_ASPCL ATP-dependent RNA helicase sub2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sub2 PE=3 SV=1 1 438 0.0E+00
sp|A2R0B5|SUB2_ASPNC ATP-dependent RNA helicase sub2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sub2 PE=3 SV=1 1 438 0.0E+00
sp|Q2U6P7|SUB2_ASPOR ATP-dependent RNA helicase sub2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sub2 PE=3 SV=1 1 438 0.0E+00
sp|A6R603|SUB2_AJECN ATP-dependent RNA helicase SUB2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SUB2 PE=3 SV=2 1 438 0.0E+00
sp|Q4WCW2|SUB2_ASPFU ATP-dependent RNA helicase sub2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sub2 PE=3 SV=1 1 438 0.0E+00
sp|Q5ASK8|SUB2_EMENI ATP-dependent RNA helicase sub2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sub2 PE=3 SV=2 1 438 0.0E+00
sp|Q0CGJ9|SUB2_ASPTN ATP-dependent RNA helicase sub2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sub2 PE=3 SV=1 1 438 0.0E+00
sp|A7EIX7|SUB2_SCLS1 ATP-dependent RNA helicase sub2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sub2 PE=3 SV=1 4 436 0.0E+00
sp|A5E3W5|SUB2_LODEL ATP-dependent RNA helicase SUB2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SUB2 PE=3 SV=1 3 439 0.0E+00
sp|A3LST5|SUB2_PICST ATP-dependent RNA helicase SUB2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SUB2 PE=3 SV=1 1 439 0.0E+00
sp|Q6BME5|SUB2_DEBHA ATP-dependent RNA helicase SUB2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUB2 PE=3 SV=2 1 439 0.0E+00
sp|A5DDN0|SUB2_PICGU ATP-dependent RNA helicase SUB2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SUB2 PE=3 SV=3 4 439 0.0E+00
sp|Q0TXZ2|SUB2_PHANO ATP-dependent RNA helicase SUB2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SUB2 PE=3 SV=1 1 437 0.0E+00
sp|Q6CH90|SUB2_YARLI ATP-dependent RNA helicase SUB2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SUB2 PE=3 SV=2 1 439 0.0E+00
sp|A7TLA0|SUB21_VANPO ATP-dependent RNA helicase SUB2-1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SUB2-1 PE=3 SV=1 1 437 0.0E+00
sp|Q759L6|SUB2_ASHGO ATP-dependent RNA helicase SUB2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SUB2 PE=3 SV=1 1 439 0.0E+00
sp|P0CQ96|SUB2_CRYNJ ATP-dependent RNA helicase SUB2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SUB2 PE=3 SV=1 4 439 0.0E+00
sp|P0CQ97|SUB2_CRYNB ATP-dependent RNA helicase SUB2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SUB2 PE=3 SV=1 4 439 0.0E+00
sp|A7TJT7|SUB22_VANPO ATP-dependent RNA helicase SUB2-2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SUB2-2 PE=3 SV=1 1 437 0.0E+00
sp|Q6CM95|SUB2_KLULA ATP-dependent RNA helicase SUB2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUB2 PE=3 SV=1 1 439 0.0E+00
sp|O13792|SUB2_SCHPO ATP-dependent RNA helicase uap56 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uap56 PE=1 SV=3 2 437 0.0E+00
sp|Q6FL17|SUB2_CANGA ATP-dependent RNA helicase SUB2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SUB2 PE=3 SV=1 1 437 0.0E+00
sp|A6ZXP4|SUB2_YEAS7 ATP-dependent RNA helicase SUB2 OS=Saccharomyces cerevisiae (strain YJM789) GN=SUB2 PE=3 SV=1 1 437 0.0E+00
sp|Q07478|SUB2_YEAST ATP-dependent RNA helicase SUB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUB2 PE=1 SV=1 1 437 0.0E+00
sp|Q0JM17|RH56_ORYSJ DEAD-box ATP-dependent RNA helicase 56 OS=Oryza sativa subsp. japonica GN=Os01g0549700 PE=2 SV=2 3 439 0.0E+00
sp|Q5RE47|DX39B_PONAB Spliceosome RNA helicase DDX39B OS=Pongo abelii GN=DDX39B PE=2 SV=1 4 437 0.0E+00
sp|Q29024|DX39B_PIG Spliceosome RNA helicase DDX39B OS=Sus scrofa GN=DDX39B PE=3 SV=2 4 437 0.0E+00
sp|P60024|DX39B_PANTR Spliceosome RNA helicase DDX39B OS=Pan troglodytes GN=DDX39B PE=3 SV=1 4 437 0.0E+00
sp|Q5TM17|DX39B_MACMU Spliceosome RNA helicase DDX39B OS=Macaca mulatta GN=DDX39B PE=3 SV=1 4 437 0.0E+00
sp|Q13838|DX39B_HUMAN Spliceosome RNA helicase DDX39B OS=Homo sapiens GN=DDX39B PE=1 SV=1 4 437 0.0E+00
sp|Q63413|DX39B_RAT Spliceosome RNA helicase Ddx39b OS=Rattus norvegicus GN=Ddx39b PE=2 SV=3 4 437 0.0E+00
sp|Q9Z1N5|DX39B_MOUSE Spliceosome RNA helicase Ddx39b OS=Mus musculus GN=Ddx39b PE=1 SV=1 4 437 0.0E+00
sp|Q3T147|DX39B_BOVIN Spliceosome RNA helicase DDX39B OS=Bos taurus GN=DDX39B PE=2 SV=1 4 437 0.0E+00
sp|Q5WR10|DX39B_CANLF Spliceosome RNA helicase DDX39B OS=Canis lupus familiaris GN=DDX39B PE=3 SV=1 4 437 0.0E+00
sp|Q5JK84|RH15_ORYSJ DEAD-box ATP-dependent RNA helicase 15 OS=Oryza sativa subsp. japonica GN=Os01g0550000 PE=2 SV=1 3 439 0.0E+00
sp|Q8VDW0|DX39A_MOUSE ATP-dependent RNA helicase DDX39A OS=Mus musculus GN=Ddx39a PE=1 SV=1 4 437 0.0E+00
sp|Q5ZHZ0|DX39B_CHICK Spliceosome RNA helicase DDX39B OS=Gallus gallus GN=DDX39B PE=2 SV=1 4 437 0.0E+00
sp|Q5U216|DX39A_RAT ATP-dependent RNA helicase DDX39A OS=Rattus norvegicus GN=Ddx39a PE=2 SV=1 4 437 0.0E+00
sp|O00148|DX39A_HUMAN ATP-dependent RNA helicase DDX39A OS=Homo sapiens GN=DDX39A PE=1 SV=2 4 437 0.0E+00
sp|Q9LFN6|RH56_ARATH DEAD-box ATP-dependent RNA helicase 56 OS=Arabidopsis thaliana GN=RH56 PE=1 SV=2 39 439 0.0E+00
sp|Q56XG6|RH15_ARATH DEAD-box ATP-dependent RNA helicase 15 OS=Arabidopsis thaliana GN=RH15 PE=1 SV=3 39 439 0.0E+00
sp|Q18212|DX39B_CAEEL Spliceosome RNA helicase DDX39B homolog OS=Caenorhabditis elegans GN=hel-1 PE=2 SV=1 4 437 0.0E+00
sp|Q27268|DX39B_DROME ATP-dependent RNA helicase WM6 OS=Drosophila melanogaster GN=Hel25E PE=1 SV=1 1 437 0.0E+00
sp|Q4WEB4|FAL1_ASPFU ATP-dependent RNA helicase fal1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fal1 PE=3 SV=2 27 432 1.0E-82
sp|A4QU31|FAL1_MAGO7 ATP-dependent RNA helicase FAL1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=FAL1 PE=3 SV=1 37 432 1.0E-82
sp|Q5AUL4|FAL1_EMENI ATP-dependent RNA helicase fal1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fal1 PE=3 SV=1 57 432 5.0E-82
sp|A1D071|FAL1_NEOFI ATP-dependent RNA helicase fal1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=fal1 PE=3 SV=1 57 432 6.0E-82
sp|Q0CAS8|FAL1_ASPTN ATP-dependent RNA helicase fal1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=fal1 PE=3 SV=1 57 432 6.0E-82
sp|Q2UAK1|FAL1_ASPOR ATP-dependent RNA helicase fal1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fal1 PE=3 SV=1 57 432 9.0E-82
sp|Q9P735|FAL1_NEUCR ATP-dependent RNA helicase fal-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fal-1 PE=3 SV=2 50 432 9.0E-82
sp|A5AAE5|FAL1_ASPNC ATP-dependent RNA helicase fal1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=fal1 PE=3 SV=2 57 432 1.0E-81
sp|A6QSQ0|FAL1_AJECN ATP-dependent RNA helicase FAL1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=FAL1 PE=3 SV=1 57 430 2.0E-81
sp|Q4IAA0|FAL1_GIBZE ATP-dependent RNA helicase FAL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FAL1 PE=3 SV=1 37 432 2.0E-81
sp|A1C595|FAL1_ASPCL ATP-dependent RNA helicase fal1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=fal1 PE=3 SV=1 57 432 3.0E-81
sp|Q10055|FAL1_SCHPO ATP-dependent RNA helicase fal1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif412 PE=1 SV=1 33 427 3.0E-81
sp|Q6CSZ7|DHH1_KLULA ATP-dependent RNA helicase DHH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DHH1 PE=3 SV=1 56 438 3.0E-81
sp|A7EM88|FAL1_SCLS1 ATP-dependent RNA helicase fal1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=fal1 PE=3 SV=1 57 435 3.0E-81
sp|Q9VHS8|IF4A3_DROME Eukaryotic initiation factor 4A-III OS=Drosophila melanogaster GN=eIF4AIII PE=1 SV=1 57 432 5.0E-81
sp|Q1DTB3|FAL1_COCIM ATP-dependent RNA helicase FAL1 OS=Coccidioides immitis (strain RS) GN=FAL1 PE=3 SV=2 57 432 7.0E-81
sp|A6S4N4|FAL1_BOTFB ATP-dependent RNA helicase fal1 OS=Botryotinia fuckeliana (strain B05.10) GN=fal1 PE=3 SV=1 57 435 9.0E-81
sp|Q2GWJ5|FAL1_CHAGB ATP-dependent RNA helicase FAL1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=FAL1 PE=3 SV=1 37 416 1.0E-79
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 20 432 1.0E-79
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 20 432 1.0E-79
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 20 432 1.0E-79
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 62 432 2.0E-79
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 20 432 2.0E-79
sp|P39517|DHH1_YEAST ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHH1 PE=1 SV=1 57 438 4.0E-79
sp|A6ZXG9|DHH1_YEAS7 ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DHH1 PE=3 SV=1 57 438 4.0E-79
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 62 432 4.0E-79
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 62 432 5.0E-79
sp|Q6C0X2|DHH1_YARLI ATP-dependent RNA helicase DHH1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DHH1 PE=3 SV=1 55 438 7.0E-79
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 62 432 1.0E-78
sp|Q7ZVA6|IF4A3_DANRE Eukaryotic initiation factor 4A-III OS=Danio rerio GN=eif4a3 PE=2 SV=1 62 432 1.0E-78
sp|Q4P184|FAL1_USTMA ATP-dependent RNA helicase FAL1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=FAL1 PE=3 SV=1 54 427 2.0E-78
sp|Q75BS4|DHH1_ASHGO ATP-dependent RNA helicase DHH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DHH1 PE=3 SV=1 57 438 3.0E-78
sp|Q6FJG1|FAL1_CANGA ATP-dependent RNA helicase FAL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FAL1 PE=3 SV=1 57 429 3.0E-78
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 62 432 3.0E-78
sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 62 432 3.0E-78
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 62 432 6.0E-78
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 62 432 6.0E-78
sp|A7TGU7|DHH1_VANPO ATP-dependent RNA helicase DHH1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DHH1 PE=3 SV=1 57 439 9.0E-78
sp|Q6FQU5|DHH1_CANGA ATP-dependent RNA helicase DHH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DHH1 PE=3 SV=1 56 438 1.0E-77
sp|P27639|IF4A_CAEEL Eukaryotic initiation factor 4A OS=Caenorhabditis elegans GN=inf-1 PE=2 SV=1 56 432 3.0E-77
sp|A5DE68|FAL1_PICGU ATP-dependent RNA helicase FAL1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=FAL1 PE=3 SV=2 50 429 1.0E-76
sp|Q109G2|RH12_ORYSJ DEAD-box ATP-dependent RNA helicase 12 OS=Oryza sativa subsp. japonica GN=Os10g0503700 PE=2 SV=2 8 436 1.0E-76
sp|A3LWX3|DHH1_PICST ATP-dependent RNA helicase DHH1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHH1 PE=3 SV=1 57 438 1.0E-76
sp|A7TEF4|FAL1_VANPO ATP-dependent RNA helicase FAL1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=FAL1 PE=3 SV=1 54 429 2.0E-76
sp|Q6C347|FAL1_YARLI ATP-dependent RNA helicase FAL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAL1 PE=3 SV=1 57 432 2.0E-76
sp|Q6BJX6|DHH1_DEBHA ATP-dependent RNA helicase DHH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DHH1 PE=3 SV=2 57 438 3.0E-76
sp|Q94A52|RH2_ARATH DEAD-box ATP-dependent RNA helicase 2 OS=Arabidopsis thaliana GN=RH2 PE=2 SV=2 55 432 4.0E-76
sp|Q55D61|IF4A_DICDI Eukaryotic initiation factor 4A OS=Dictyostelium discoideum GN=tifA PE=3 SV=1 29 427 4.0E-76
sp|Q6CX73|FAL1_KLULA ATP-dependent RNA helicase FAL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FAL1 PE=3 SV=1 54 427 9.0E-76
sp|P0CQ72|FAL1_CRYNJ ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=FAL1 PE=3 SV=1 57 427 2.0E-75
sp|P0CQ73|FAL1_CRYNB ATP-dependent RNA helicase FAL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=FAL1 PE=3 SV=1 57 427 2.0E-75
sp|Q1E5R1|DHH1_COCIM ATP-dependent RNA helicase DHH1 OS=Coccidioides immitis (strain RS) GN=DHH1 PE=3 SV=1 57 437 3.0E-75
sp|Q2U5A2|DHH1_ASPOR ATP-dependent RNA helicase dhh1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dhh1 PE=3 SV=1 57 437 3.0E-75
sp|Q12099|FAL1_YEAST ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAL1 PE=1 SV=1 54 427 3.0E-75
sp|A6ZXY5|FAL1_YEAS7 ATP-dependent RNA helicase FAL1 OS=Saccharomyces cerevisiae (strain YJM789) GN=FAL1 PE=3 SV=1 54 427 3.0E-75
sp|Q0CBE1|DHH1_ASPTN ATP-dependent RNA helicase dhh1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dhh1 PE=3 SV=1 57 437 3.0E-75
sp|A1D8G1|DHH1_NEOFI ATP-dependent RNA helicase dhh1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dhh1 PE=3 SV=1 57 437 3.0E-75
sp|Q7XMK8|RH6_ORYSJ DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sativa subsp. japonica GN=Os04g0533000 PE=2 SV=1 57 436 4.0E-75
sp|Q5AAW3|DHH1_CANAL ATP-dependent RNA helicase DHH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DHH1 PE=3 SV=1 57 438 4.0E-75
sp|Q4WWD3|DHH1_ASPFU ATP-dependent RNA helicase dhh1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dhh1 PE=3 SV=1 57 437 5.0E-75
sp|Q8RXK6|RH8_ARATH DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana GN=RH8 PE=2 SV=1 4 436 7.0E-75
sp|A6RY31|DHH1_BOTFB ATP-dependent RNA helicase dhh1 OS=Botryotinia fuckeliana (strain B05.10) GN=dhh1 PE=3 SV=1 57 428 8.0E-75
sp|P54823|DDX6_MOUSE Probable ATP-dependent RNA helicase DDX6 OS=Mus musculus GN=Ddx6 PE=1 SV=1 57 438 9.0E-75
sp|P26196|DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens GN=DDX6 PE=1 SV=2 57 438 1.0E-74
sp|A2QY39|DHH1_ASPNC ATP-dependent RNA helicase dhh1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dhh1 PE=3 SV=1 57 437 1.0E-74
sp|Q94BV4|RH6_ARATH DEAD-box ATP-dependent RNA helicase 6 OS=Arabidopsis thaliana GN=RH6 PE=2 SV=2 57 404 2.0E-74
sp|A1CJ18|DHH1_ASPCL ATP-dependent RNA helicase dhh1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dhh1 PE=3 SV=1 57 437 2.0E-74
sp|Q5ZKB9|DDX6_CHICK Probable ATP-dependent RNA helicase DDX6 OS=Gallus gallus GN=DDX6 PE=2 SV=1 57 438 2.0E-74
sp|Q2GQ93|DHH1_CHAGB ATP-dependent RNA helicase DHH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DHH1 PE=3 SV=1 57 437 2.0E-74
sp|Q9WTM2|DDX6_CAVPO Probable ATP-dependent RNA helicase DDX6 (Fragment) OS=Cavia porcellus GN=DDX6 PE=2 SV=1 57 438 3.0E-74
sp|Q0IHV9|DDX6_XENTR Probable ATP-dependent RNA helicase ddx6 OS=Xenopus tropicalis GN=ddx6 PE=2 SV=1 57 438 3.0E-74
sp|Q58Z64|DHH1_CRYNH ATP-dependent RNA helicase VAD1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=VAD1 PE=2 SV=1 57 438 3.0E-74
sp|Q0U7S9|DHH1_PHANO ATP-dependent RNA helicase DHH1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DHH1 PE=3 SV=1 57 428 3.0E-74
sp|O02494|IF4A_CRYPV Eukaryotic initiation factor 4A OS=Cryptosporidium parvum GN=EIF4-A PE=2 SV=1 57 427 3.0E-74
sp|Q9M2E0|RH12_ARATH DEAD-box ATP-dependent RNA helicase 12 OS=Arabidopsis thaliana GN=RH12 PE=2 SV=1 24 436 3.0E-74
sp|A5DWJ1|FAL1_LODEL ATP-dependent RNA helicase FAL1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=FAL1 PE=3 SV=1 50 427 5.0E-74
sp|P41380|IF4A3_NICPL Eukaryotic initiation factor 4A-3 OS=Nicotiana plumbaginifolia PE=2 SV=1 57 432 5.0E-74
sp|A3GFV3|FAL1_PICST ATP-dependent RNA helicase FAL1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=FAL1 PE=3 SV=1 45 427 6.0E-74
sp|A5DIP0|DHH1_PICGU ATP-dependent RNA helicase DHH1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DHH1 PE=3 SV=1 57 438 7.0E-74
sp|P35683|IF4A1_ORYSJ Eukaryotic initiation factor 4A-1 OS=Oryza sativa subsp. japonica GN=Os06g0701100 PE=2 SV=2 48 432 9.0E-74
sp|Q6BT27|FAL1_DEBHA ATP-dependent RNA helicase FAL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FAL1 PE=3 SV=1 45 427 9.0E-74
sp|P0CQ80|DHH1_CRYNJ ATP-dependent RNA helicase DHH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DHH1 PE=3 SV=1 57 438 1.0E-73
sp|P0CQ81|DHH1_CRYNB ATP-dependent RNA helicase DHH1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DHH1 PE=3 SV=1 57 438 1.0E-73
sp|Q54E49|DDX6_DICDI Probable ATP-dependent RNA helicase ddx6 OS=Dictyostelium discoideum GN=ddx6 PE=3 SV=1 57 438 1.0E-73
sp|Q6H7S2|RH8_ORYSJ DEAD-box ATP-dependent RNA helicase 8 OS=Oryza sativa subsp. japonica GN=Os02g0641800 PE=2 SV=2 57 436 1.0E-73
sp|Q9CAI7|IF4A3_ARATH Eukaryotic initiation factor 4A-3 OS=Arabidopsis thaliana GN=TIF4A-3 PE=1 SV=1 62 432 1.0E-73
sp|Q5RFQ5|DDX6_PONAB Probable ATP-dependent RNA helicase DDX6 OS=Pongo abelii GN=DDX6 PE=2 SV=1 57 438 2.0E-73
sp|P23128|DDX6_DROME Putative ATP-dependent RNA helicase me31b OS=Drosophila melanogaster GN=me31B PE=1 SV=3 57 439 2.0E-73
sp|P54824|DDX6_XENLA ATP-dependent RNA helicase ddx6 OS=Xenopus laevis GN=ddx6 PE=1 SV=2 57 438 3.0E-73
sp|Q09181|DHH1_SCHPO Putative ATP-dependent RNA helicase ste13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste13 PE=3 SV=1 55 437 4.0E-73
sp|Q95YF3|CGH1_CAEEL ATP-dependent RNA helicase cgh-1 OS=Caenorhabditis elegans GN=cgh-1 PE=1 SV=1 16 438 7.0E-73
sp|P41381|IF4A8_TOBAC Eukaryotic initiation factor 4A-8 OS=Nicotiana tabacum PE=2 SV=1 31 432 9.0E-73
sp|Q4HW67|DHH1_GIBZE ATP-dependent RNA helicase DHH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DHH1 PE=3 SV=1 33 437 1.0E-72
sp|Q40471|IF4A9_TOBAC Eukaryotic initiation factor 4A-9 OS=Nicotiana tabacum PE=2 SV=1 31 432 1.0E-72
sp|Q9C8J1|RH34_ARATH DEAD-box ATP-dependent RNA helicase 34 OS=Arabidopsis thaliana GN=RH34 PE=2 SV=2 57 431 1.0E-72
sp|P41378|IF4A_WHEAT Eukaryotic initiation factor 4A OS=Triticum aestivum PE=2 SV=1 48 432 2.0E-72
sp|Q10I26|RH34_ORYSJ DEAD-box ATP-dependent RNA helicase 34 OS=Oryza sativa subsp. japonica GN=Os03g0566800 PE=2 SV=1 55 432 2.0E-72
sp|A4R715|DHH1_MAGO7 ATP-dependent RNA helicase DHH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DHH1 PE=3 SV=2 57 437 2.0E-72
sp|P41382|IF410_TOBAC Eukaryotic initiation factor 4A-10 OS=Nicotiana tabacum PE=2 SV=1 62 432 4.0E-72
sp|Q5A9Z6|FAL1_CANAL ATP-dependent RNA helicase FAL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FAL1 PE=3 SV=1 50 427 4.0E-72
sp|Q7S5D9|DHH1_NEUCR ATP-dependent RNA helicase dhh1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-10 PE=3 SV=3 57 437 4.0E-72
sp|P41376|IF4A1_ARATH Eukaryotic initiation factor 4A-1 OS=Arabidopsis thaliana GN=TIF4A-1 PE=1 SV=1 48 432 7.0E-72
sp|Q40468|IF415_TOBAC Eukaryotic initiation factor 4A-15 OS=Nicotiana tabacum PE=2 SV=1 33 432 7.0E-72
sp|Q6Z2Z4|IF4A3_ORYSJ Eukaryotic initiation factor 4A-3 OS=Oryza sativa subsp. japonica GN=Os02g0146600 PE=2 SV=1 57 432 8.0E-72
sp|Q5VNM3|RH2_ORYSJ DEAD-box ATP-dependent RNA helicase 2 OS=Oryza sativa subsp. japonica GN=Os01g0639100 PE=2 SV=1 55 432 8.0E-72
sp|Q40467|IF414_TOBAC Eukaryotic initiation factor 4A-14 OS=Nicotiana tabacum PE=2 SV=1 62 432 1.0E-71
sp|P41377|IF4A2_ARATH Eukaryotic initiation factor 4A-2 OS=Arabidopsis thaliana GN=TIF4A-2 PE=1 SV=1 48 432 1.0E-71
sp|Q0UAT0|FAL1_PHANO ATP-dependent RNA helicase FAL1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=FAL1 PE=3 SV=3 33 432 2.0E-71
sp|Q7RV88|IF4A_NEUCR ATP-dependent RNA helicase eIF4A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tif-1 PE=3 SV=2 56 432 2.0E-71
sp|A5DVM3|IF4A_LODEL ATP-dependent RNA helicase eIF4A OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TIF1 PE=3 SV=1 57 429 2.0E-71
sp|Q2HFP1|IF4A_CHAGB ATP-dependent RNA helicase eIF4A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF1 PE=3 SV=1 56 432 3.0E-71
sp|Q40470|IF4A7_TOBAC Eukaryotic initiation factor 4A-7 OS=Nicotiana tabacum PE=2 SV=1 62 432 4.0E-71
sp|P41379|IF4A2_NICPL Eukaryotic initiation factor 4A-2 OS=Nicotiana plumbaginifolia PE=2 SV=1 62 432 4.0E-71
sp|Q40465|IF411_TOBAC Eukaryotic initiation factor 4A-11 OS=Nicotiana tabacum PE=2 SV=1 62 432 5.0E-71
sp|Q41741|IF4A_MAIZE Eukaryotic initiation factor 4A OS=Zea mays PE=2 SV=1 62 432 1.0E-70
sp|A1D7N3|IF4A_NEOFI ATP-dependent RNA helicase eIF4A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tif1 PE=3 SV=1 56 432 4.0E-70
sp|A1CJT5|IF4A_ASPCL ATP-dependent RNA helicase eIF4A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tif1 PE=3 SV=1 56 432 4.0E-70
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 57 407 6.0E-70
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 57 407 6.0E-70
sp|Q02748|IF4A_DROME Eukaryotic initiation factor 4A OS=Drosophila melanogaster GN=eIF-4a PE=1 SV=3 56 432 1.0E-69
sp|A6RJ45|IF4A_BOTFB ATP-dependent RNA helicase eIF4A OS=Botryotinia fuckeliana (strain B05.10) GN=tif1 PE=3 SV=1 56 432 2.0E-69
sp|Q4WX43|IF4A_ASPFU ATP-dependent RNA helicase eIF4A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tif1 PE=3 SV=1 62 427 2.0E-69
sp|Q5B948|IF4A_EMENI ATP-dependent RNA helicase eIF4A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tif1 PE=3 SV=2 56 432 2.0E-69
sp|Q6BRN4|IF4A_DEBHA ATP-dependent RNA helicase eIF4A OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIF1 PE=3 SV=1 57 429 3.0E-69
sp|P0A9P8|DEAD_SHIFL ATP-dependent RNA helicase DeaD OS=Shigella flexneri GN=deaD PE=3 SV=2 55 425 4.0E-69
sp|P0A9P6|DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) GN=deaD PE=1 SV=2 55 425 4.0E-69
sp|P0A9P7|DEAD_ECOL6 ATP-dependent RNA helicase DeaD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=deaD PE=3 SV=2 55 425 4.0E-69
sp|Q8XA87|DEAD_ECO57 ATP-dependent RNA helicase DeaD OS=Escherichia coli O157:H7 GN=deaD PE=3 SV=3 55 425 4.0E-69
sp|Q755W0|FAL1_ASHGO ATP-dependent RNA helicase FAL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=FAL1 PE=3 SV=2 54 429 5.0E-69
sp|A5DB98|IF4A_PICGU ATP-dependent RNA helicase eIF4A OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TIF1 PE=3 SV=1 56 427 5.0E-69
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 55 417 6.0E-69
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 55 417 7.0E-69
sp|Q0UU86|IF4A_PHANO ATP-dependent RNA helicase eIF4A OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TIF1 PE=3 SV=1 62 432 8.0E-69
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 55 417 8.0E-69
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 55 417 8.0E-69
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 55 417 8.0E-69
sp|Q38F76|IF4A_TRYB2 Probable eukaryotic initiation factor 4A OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb09.160.3270 PE=3 SV=1 57 438 8.0E-69
sp|P0C218|DDX20_DANRE Probable ATP-dependent RNA helicase DDX20 OS=Danio rerio GN=ddx20 PE=3 SV=1 57 427 8.0E-69
sp|A7EGL7|IF4A_SCLS1 ATP-dependent RNA helicase eIF4A OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tif1 PE=3 SV=1 56 432 1.0E-68
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 55 417 1.0E-68
sp|A4QVP2|IF4A_MAGO7 ATP-dependent RNA helicase eIF4A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TIF1 PE=3 SV=1 56 432 1.0E-68
sp|Q0CXD0|IF4A_ASPTN ATP-dependent RNA helicase eIF4A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tif1 PE=3 SV=2 56 432 1.0E-68
sp|P87206|IF4A_CANAL ATP-dependent RNA helicase eIF4A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIF1 PE=3 SV=1 57 429 2.0E-68
sp|P0CQ70|IF4A_CRYNJ ATP-dependent RNA helicase eIF4A OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIF1 PE=3 SV=1 56 427 2.0E-68
sp|P0CQ71|IF4A_CRYNB ATP-dependent RNA helicase eIF4A OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TIF1 PE=3 SV=1 56 427 2.0E-68
sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cshA PE=3 SV=1 57 417 2.0E-68
sp|Q9UHI6|DDX20_HUMAN Probable ATP-dependent RNA helicase DDX20 OS=Homo sapiens GN=DDX20 PE=1 SV=2 57 427 2.0E-68
sp|Q9JJY4|DDX20_MOUSE Probable ATP-dependent RNA helicase DDX20 OS=Mus musculus GN=Ddx20 PE=1 SV=2 40 421 4.0E-68
sp|P33906|DEAD_KLEPN ATP-dependent RNA helicase DeaD OS=Klebsiella pneumoniae GN=deaD PE=3 SV=3 55 425 6.0E-68
sp|Q4E162|IF4A_TRYCC Probable eukaryotic initiation factor 4A OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053511585.190 PE=3 SV=1 57 438 1.0E-67
sp|Q6CDV4|IF4A_YARLI ATP-dependent RNA helicase eIF4A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIF1 PE=3 SV=1 55 432 1.0E-67
sp|Q6CXT4|IF4A_KLULA ATP-dependent RNA helicase eIF4A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIF1 PE=3 SV=1 56 427 2.0E-67
sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 57 417 2.0E-67
sp|Q2UPY3|IF4A_ASPOR ATP-dependent RNA helicase eIF4A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tif1 PE=3 SV=1 62 432 2.0E-67
sp|A2QEN5|IF4A_ASPNC ATP-dependent RNA helicase eIF4A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tif1 PE=3 SV=1 56 432 3.0E-67
sp|A3GFI4|IF4A_PICST ATP-dependent RNA helicase eIF4A OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TIF1 PE=3 SV=1 57 429 3.0E-67
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 55 403 4.0E-67
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 53 427 6.0E-67
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 53 427 7.0E-67
sp|Q1DQ20|IF4A_COCIM ATP-dependent RNA helicase eIF4A OS=Coccidioides immitis (strain RS) GN=TIF1 PE=3 SV=1 29 432 8.0E-67
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 57 424 9.0E-67
sp|A7TK55|IF4A_VANPO ATP-dependent RNA helicase eIF4A OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TIF1 PE=3 SV=1 57 429 1.0E-66
sp|Q9Z6C9|CSHA_LACRE ATP-dependent RNA helicase CshA OS=Lactobacillus reuteri GN=cshA PE=3 SV=1 57 433 2.0E-66
sp|Q6FQQ6|IF4A_CANGA ATP-dependent RNA helicase eIF4A OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIF1 PE=3 SV=1 57 429 3.0E-66
sp|O62591|IF4A_LEIMA Probable eukaryotic initiation factor 4A OS=Leishmania major GN=LmjF.01.0770 PE=3 SV=1 56 438 4.0E-66
sp|A4HRK0|IF4A_LEIIN Probable eukaryotic initiation factor 4A OS=Leishmania infantum GN=LinJ01.0780 PE=3 SV=1 56 438 4.0E-66
sp|P10081|IF4A_YEAST ATP-dependent RNA helicase eIF4A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF1 PE=1 SV=3 57 429 5.0E-66
sp|A6ZQJ1|IF4A_YEAS7 ATP-dependent RNA helicase eIF4A OS=Saccharomyces cerevisiae (strain YJM789) GN=TIF1 PE=3 SV=1 57 429 5.0E-66
sp|Q25225|IF4A_LEIBR Probable eukaryotic initiation factor 4A OS=Leishmania braziliensis GN=LbrM01_V2.0740 PE=3 SV=2 56 438 7.0E-66
sp|P47943|IF4A_SCHPO ATP-dependent RNA helicase eIF4A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif1 PE=1 SV=2 57 432 2.0E-65
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 55 404 1.0E-64
sp|Q4R8K5|IF4A1_MACFA Eukaryotic initiation factor 4A-I OS=Macaca fascicularis GN=EIF4A1 PE=2 SV=1 56 432 2.0E-64
sp|Q5RKI1|IF4A2_RAT Eukaryotic initiation factor 4A-II OS=Rattus norvegicus GN=Eif4a2 PE=1 SV=1 56 432 2.0E-64
sp|Q5R4X1|IF4A2_PONAB Eukaryotic initiation factor 4A-II OS=Pongo abelii GN=EIF4A2 PE=2 SV=1 56 432 2.0E-64
sp|P10630|IF4A2_MOUSE Eukaryotic initiation factor 4A-II OS=Mus musculus GN=Eif4a2 PE=1 SV=2 56 432 2.0E-64
sp|Q14240|IF4A2_HUMAN Eukaryotic initiation factor 4A-II OS=Homo sapiens GN=EIF4A2 PE=1 SV=2 56 432 2.0E-64
sp|Q3SZ65|IF4A2_BOVIN Eukaryotic initiation factor 4A-II OS=Bos taurus GN=EIF4A2 PE=2 SV=1 56 432 2.0E-64
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 57 417 2.0E-64
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 57 417 2.0E-64
sp|P29562|IF4A1_RABIT Eukaryotic initiation factor 4A-I (Fragment) OS=Oryctolagus cuniculus GN=EIF4A1 PE=1 SV=2 56 432 4.0E-64
sp|Q4R4Y9|IF4A2_MACFA Eukaryotic initiation factor 4A-II OS=Macaca fascicularis GN=EIF4A2 PE=2 SV=1 56 432 4.0E-64
sp|P60843|IF4A1_MOUSE Eukaryotic initiation factor 4A-I OS=Mus musculus GN=Eif4a1 PE=1 SV=1 56 432 5.0E-64
sp|P60842|IF4A1_HUMAN Eukaryotic initiation factor 4A-I OS=Homo sapiens GN=EIF4A1 PE=1 SV=1 56 432 5.0E-64
sp|Q3SZ54|IF4A1_BOVIN Eukaryotic initiation factor 4A-I OS=Bos taurus GN=EIF4A1 PE=2 SV=1 56 432 5.0E-64
sp|Q8JFP1|IF4A2_CHICK Eukaryotic initiation factor 4A-II OS=Gallus gallus GN=EIF4A2 PE=2 SV=1 56 432 5.0E-64
sp|Q89AF9|DEAD_BUCBP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=deaD PE=3 SV=1 57 428 5.0E-64
sp|Q5R5F5|IF4A1_PONAB Eukaryotic initiation factor 4A-I OS=Pongo abelii GN=EIF4A1 PE=2 SV=1 59 427 1.0E-63
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 57 427 2.0E-63
sp|A5A6N4|IF4A1_PANTR Eukaryotic initiation factor 4A-I OS=Pan troglodytes GN=EIF4A1 PE=2 SV=1 56 432 2.0E-63
sp|Q4P331|IF4A_USTMA ATP-dependent RNA helicase eIF4A OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TIF1 PE=3 SV=1 56 432 2.0E-63
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 74 417 4.0E-63
sp|A6R3R5|IF4A_AJECN ATP-dependent RNA helicase eIF4A OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=TIF1 PE=3 SV=1 62 418 4.0E-63
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 57 429 5.0E-63
sp|Q75BL8|IF4A_ASHGO ATP-dependent RNA helicase eIF4A OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIF1 PE=3 SV=1 57 432 8.0E-63
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 57 427 8.0E-63
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 54 431 2.0E-62
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 57 426 3.0E-62
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 62 428 3.0E-62
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 57 430 4.0E-62
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 53 426 9.0E-62
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 53 426 9.0E-62
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 52 426 2.0E-61
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 57 425 2.0E-61
sp|Q8Y7M8|DBPA_LISMO ATP-dependent RNA helicase DbpA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dbpA PE=2 SV=1 57 423 4.0E-61
sp|Q8K9H6|DEAD_BUCAP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=deaD PE=3 SV=1 53 428 6.0E-61
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 57 429 9.0E-61
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 56 427 2.0E-60
sp|Q93ZG7|RH38_ARATH DEAD-box ATP-dependent RNA helicase 38 OS=Arabidopsis thaliana GN=RH38 PE=1 SV=2 54 426 3.0E-60
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 57 429 4.0E-60
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 57 429 2.0E-59
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 57 426 2.0E-59
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 55 427 2.0E-59
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 21 429 2.0E-59
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 57 433 2.0E-59
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 57 429 3.0E-59
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 57 429 4.0E-59
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 57 429 7.0E-59
sp|Q4FZF3|DDX49_MOUSE Probable ATP-dependent RNA helicase DDX49 OS=Mus musculus GN=Ddx49 PE=2 SV=1 56 426 1.0E-58
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 57 429 2.0E-58
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 57 425 2.0E-58
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 57 427 3.0E-58
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 57 429 4.0E-58
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 57 429 7.0E-58
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 54 416 8.0E-58
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 36 429 4.0E-57
sp|P21693|DBPA_ECOLI ATP-dependent RNA helicase DbpA OS=Escherichia coli (strain K12) GN=dbpA PE=1 SV=2 61 409 5.0E-57
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 57 429 6.0E-57
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 57 436 6.0E-57
sp|Q8Y755|CSHB_LISMO DEAD-box ATP-dependent RNA helicase CshB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshB PE=2 SV=1 57 417 6.0E-57
sp|Q8SQK9|DHH1_ENCCU ATP-dependent RNA helicase DHH1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DHH1 PE=3 SV=2 56 419 6.0E-57
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 54 420 7.0E-57
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 55 438 8.0E-57
sp|P54475|CSHB_BACSU DEAD-box ATP-dependent RNA helicase CshB OS=Bacillus subtilis (strain 168) GN=cshB PE=1 SV=1 55 417 1.0E-56
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 57 427 1.0E-56
sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens GN=DDX49 PE=1 SV=1 56 429 2.0E-56
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 57 437 3.0E-56
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 57 431 1.0E-55
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 57 437 1.0E-55
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 57 437 2.0E-55
sp|A5DBI5|DBP5_PICGU ATP-dependent RNA helicase DBP5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP5 PE=3 SV=1 56 432 2.0E-55
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 9 417 4.0E-55
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 13 438 5.0E-55
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 57 433 9.0E-55
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 57 433 1.0E-54
sp|A3GH91|DBP5_PICST ATP-dependent RNA helicase DBP5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP5 PE=3 SV=2 56 432 1.0E-54
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 57 404 1.0E-54
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 57 433 1.0E-54
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 57 404 1.0E-54
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 57 404 1.0E-54
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 57 404 1.0E-54
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 57 404 1.0E-54
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 57 404 1.0E-54
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 57 404 1.0E-54
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 57 404 1.0E-54
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 57 404 1.0E-54
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 52 426 1.0E-54
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 57 404 1.0E-54
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 57 404 2.0E-54
sp|Q10RI7|RH38_ORYSJ DEAD-box ATP-dependent RNA helicase 38 OS=Oryza sativa subsp. japonica GN=Os03g0158200 PE=3 SV=1 47 425 3.0E-54
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 57 432 3.0E-54
sp|Q54ZI9|DDX20_DICDI Probable ATP-dependent RNA helicase ddx20 OS=Dictyostelium discoideum GN=ddx20 PE=3 SV=2 57 404 6.0E-54
sp|P20449|DBP5_YEAST ATP-dependent RNA helicase DBP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP5 PE=1 SV=2 56 432 7.0E-54
sp|A6ZNQ1|DBP5_YEAS7 ATP-dependent RNA helicase DBP5 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP5 PE=3 SV=1 56 432 7.0E-54
sp|Q75C39|DBP5_ASHGO ATP-dependent RNA helicase DBP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP5 PE=3 SV=2 14 432 2.0E-53
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 57 405 2.0E-53
sp|Q818H2|CSHB_BACCR DEAD-box ATP-dependent RNA helicase CshB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshB PE=2 SV=1 57 421 2.0E-53
sp|Q54TF8|DDX19_DICDI ATP-dependent RNA helicase ddx19 OS=Dictyostelium discoideum GN=helC PE=2 SV=1 57 433 2.0E-53
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 52 413 3.0E-53
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 54 437 3.0E-53
sp|Q6C3X7|DBP5_YARLI ATP-dependent RNA helicase DBP5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP5 PE=3 SV=1 57 432 4.0E-53
sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2 57 417 6.0E-53
sp|Q2FY15|CSHB_STAA8 DEAD-box ATP-dependent RNA helicase CshB OS=Staphylococcus aureus (strain NCTC 8325) GN=cshB PE=3 SV=1 57 411 8.0E-53
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 55 420 8.0E-53
sp|Q81E85|CSHC_BACCR DEAD-box ATP-dependent RNA helicase CshC OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshC PE=2 SV=1 62 413 1.0E-52
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 57 417 1.0E-52
sp|Q09903|DRS1_SCHPO ATP-dependent RNA helicase drs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=drs1 PE=3 SV=1 33 417 2.0E-52
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 52 414 3.0E-52
sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus GN=DDX27 PE=2 SV=1 56 417 4.0E-52
sp|A3LSN3|DRS1_PICST ATP-dependent RNA helicase DRS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRS1 PE=3 SV=3 46 420 5.0E-52
sp|Q6BRE4|DBP5_DEBHA ATP-dependent RNA helicase DBP5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP5 PE=3 SV=1 56 432 6.0E-52
sp|Q8SQM5|IF4A_ENCCU ATP-dependent RNA helicase eIF4A OS=Encephalitozoon cuniculi (strain GB-M1) GN=TIF1 PE=1 SV=1 57 429 7.0E-52
sp|Q40466|IF413_TOBAC Eukaryotic initiation factor 4A-13 (Fragment) OS=Nicotiana tabacum PE=2 SV=1 62 375 7.0E-52
sp|Q4HY71|DBP5_GIBZE ATP-dependent RNA helicase DBP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP5 PE=3 SV=1 54 432 8.0E-52
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 43 426 1.0E-51
sp|A5DZX2|DBP5_LODEL ATP-dependent RNA helicase DBP5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP5 PE=3 SV=1 56 421 2.0E-51
sp|Q9UMR2|DD19B_HUMAN ATP-dependent RNA helicase DDX19B OS=Homo sapiens GN=DDX19B PE=1 SV=1 56 419 3.0E-51
sp|Q921N6|DDX27_MOUSE Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus GN=Ddx27 PE=1 SV=3 54 417 3.0E-51
sp|Q40469|IF4A6_TOBAC Eukaryotic initiation factor 4A-6 (Fragment) OS=Nicotiana tabacum PE=2 SV=1 179 432 3.0E-51
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 52 403 3.0E-51
sp|Q6CJU1|DBP5_KLULA ATP-dependent RNA helicase DBP5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP5 PE=3 SV=1 75 432 3.0E-51
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 55 435 3.0E-51
sp|Q0DBU5|RH31_ORYSJ DEAD-box ATP-dependent RNA helicase 31 OS=Oryza sativa subsp. japonica GN=Os06g0526600 PE=3 SV=2 9 404 3.0E-51
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 23 404 4.0E-51
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 50 436 4.0E-51
sp|A1CFV3|DBP5_ASPCL ATP-dependent RNA helicase dbp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp5 PE=3 SV=1 57 423 4.0E-51
sp|Q887N8|RHLB_PSESM ATP-dependent RNA helicase RhlB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rhlB PE=3 SV=1 55 419 4.0E-51
sp|Q9DBN9|DDX59_MOUSE Probable ATP-dependent RNA helicase DDX59 OS=Mus musculus GN=Ddx59 PE=1 SV=1 64 420 5.0E-51
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 49 422 6.0E-51
sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 40 404 7.0E-51
sp|Q6FKN8|DBP5_CANGA ATP-dependent RNA helicase DBP5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP5 PE=3 SV=1 56 432 7.0E-51
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 52 420 8.0E-51
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 55 413 8.0E-51
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 57 429 9.0E-51
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 55 426 1.0E-50
sp|Q8L4E9|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36 OS=Oryza sativa subsp. japonica GN=Os07g0633500 PE=3 SV=1 55 416 1.0E-50
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 33 407 1.0E-50
sp|A1D1R8|DRS1_NEOFI ATP-dependent RNA helicase drs1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=drs1 PE=3 SV=1 44 413 1.0E-50
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 52 414 1.0E-50
sp|Q6YS30|RH5_ORYSJ DEAD-box ATP-dependent RNA helicase 5 OS=Oryza sativa subsp. japonica GN=Os07g0301200 PE=2 SV=1 31 426 2.0E-50
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 57 425 2.0E-50
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 55 435 3.0E-50
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 42 426 3.0E-50
sp|Q4WRV2|DRS1_ASPFU ATP-dependent RNA helicase drs1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=drs1 PE=3 SV=1 44 413 3.0E-50
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 54 417 3.0E-50
sp|A5DY34|DRS1_LODEL ATP-dependent RNA helicase DRS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DRS1 PE=3 SV=1 48 413 3.0E-50
sp|Q5AVM1|DBP5_EMENI ATP-dependent RNA helicase dbp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp5 PE=3 SV=1 57 419 3.0E-50
sp|Q53RK8|RH21_ORYSJ DEAD-box ATP-dependent RNA helicase 21 OS=Oryza sativa subsp. japonica GN=Os03g0708600 PE=2 SV=1 42 404 3.0E-50
sp|Q3ZBV2|DD19A_BOVIN ATP-dependent RNA helicase DDX19A OS=Bos taurus GN=DDX19A PE=2 SV=1 56 419 4.0E-50
sp|Q5T1V6|DDX59_HUMAN Probable ATP-dependent RNA helicase DDX59 OS=Homo sapiens GN=DDX59 PE=1 SV=1 64 420 4.0E-50
sp|P32892|DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS1 PE=1 SV=2 57 420 4.0E-50
sp|A7A0P8|DRS1_YEAS7 ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRS1 PE=3 SV=1 57 420 4.0E-50
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 56 428 5.0E-50
sp|Q9FNM7|RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana GN=RH26 PE=1 SV=2 27 413 5.0E-50
sp|Q61655|DD19A_MOUSE ATP-dependent RNA helicase DDX19A OS=Mus musculus GN=Ddx19a PE=1 SV=2 56 432 8.0E-50
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 17 429 8.0E-50
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 43 427 8.0E-50
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 42 417 1.0E-49
sp|Q9NUU7|DD19A_HUMAN ATP-dependent RNA helicase DDX19A OS=Homo sapiens GN=DDX19A PE=1 SV=1 56 432 1.0E-49
sp|Q4WH83|DBP3_ASPFU ATP-dependent RNA helicase dbp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp3 PE=3 SV=1 75 409 1.0E-49
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 62 416 1.0E-49
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 39 404 1.0E-49
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 15 429 1.0E-49
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 39 404 1.0E-49
sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED1 PE=1 SV=2 43 431 1.0E-49
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 50 418 1.0E-49
sp|A6ZP47|DED1_YEAS7 ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DED1 PE=3 SV=1 43 431 2.0E-49
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 75 431 2.0E-49
sp|Q88NB7|RHLB_PSEPK ATP-dependent RNA helicase RhlB OS=Pseudomonas putida (strain KT2440) GN=rhlB PE=3 SV=1 55 416 2.0E-49
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 11 432 2.0E-49
sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 43 404 2.0E-49
sp|Q5Z6G5|RH35B_ORYSJ DEAD-box ATP-dependent RNA helicase 35B OS=Oryza sativa subsp. japonica GN=Os06g0697200 PE=3 SV=1 47 417 2.0E-49
sp|A1DG51|DBP3_NEOFI ATP-dependent RNA helicase dbp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp3 PE=3 SV=1 75 409 2.0E-49
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 57 415 2.0E-49
sp|A1CNV8|DRS1_ASPCL ATP-dependent RNA helicase drs1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=drs1 PE=3 SV=1 57 413 2.0E-49
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 55 404 2.0E-49
sp|A1CYG5|DBP5_NEOFI ATP-dependent RNA helicase dbp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp5 PE=3 SV=1 22 419 2.0E-49
sp|Q9SQV1|RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana GN=RH40 PE=2 SV=1 49 429 3.0E-49
sp|Q4WIN6|DBP5_ASPFU ATP-dependent RNA helicase dbp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp5 PE=3 SV=2 57 419 3.0E-49
sp|Q1DZK8|DBP3_COCIM ATP-dependent RNA helicase DBP3 OS=Coccidioides immitis (strain RS) GN=DBP3 PE=3 SV=2 75 404 3.0E-49
sp|C6DHF5|RHLB_PECCP ATP-dependent RNA helicase RhlB OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rhlB PE=3 SV=1 57 403 4.0E-49
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 59 432 4.0E-49
sp|Q9M2F9|RH52_ARATH DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana GN=RH52 PE=1 SV=1 43 427 5.0E-49
sp|A2QUY7|DBP5_ASPNC ATP-dependent RNA helicase dbp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp5 PE=3 SV=1 57 419 5.0E-49
sp|A7F4L5|DRS1_SCLS1 ATP-dependent RNA helicase drs1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=drs1 PE=3 SV=1 46 413 6.0E-49
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 43 426 6.0E-49
sp|Q6FP38|DBP1_CANGA ATP-dependent RNA helicase DBP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP1 PE=3 SV=1 43 428 6.0E-49
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1 62 437 7.0E-49
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 43 427 7.0E-49
sp|Q0CZN5|DRS1_ASPTN ATP-dependent RNA helicase drs1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=drs1 PE=3 SV=1 57 413 7.0E-49
sp|A1C5V3|DBP3_ASPCL ATP-dependent RNA helicase dbp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp3 PE=3 SV=1 73 409 8.0E-49
sp|Q5AWA6|DBP3_EMENI ATP-dependent RNA helicase dbp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp3 PE=3 SV=2 74 426 8.0E-49
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 55 421 8.0E-49
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 55 421 8.0E-49
sp|A6RC50|DBP5_AJECN ATP-dependent RNA helicase DBP5 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP5 PE=3 SV=1 57 419 8.0E-49
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 41 429 9.0E-49
sp|Q94C75|RH25_ARATH DEAD-box ATP-dependent RNA helicase 25 OS=Arabidopsis thaliana GN=RH25 PE=2 SV=2 52 431 1.0E-48
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 56 429 1.0E-48
sp|A6RUH2|DRS1_BOTFB ATP-dependent RNA helicase drs1 OS=Botryotinia fuckeliana (strain B05.10) GN=drs1 PE=3 SV=1 54 413 1.0E-48
sp|Q9HXE5|RHLB_PSEAE ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlB PE=3 SV=1 55 417 2.0E-48
sp|Q02S21|RHLB_PSEAB ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rhlB PE=3 SV=1 55 417 2.0E-48
sp|B7UUT0|RHLB_PSEA8 ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain LESB58) GN=rhlB PE=3 SV=1 55 417 2.0E-48
sp|Q6CZD9|RHLB_PECAS ATP-dependent RNA helicase RhlB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rhlB PE=3 SV=3 57 403 2.0E-48
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 24 404 2.0E-48
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 75 407 3.0E-48
sp|Q2UQI6|DRS1_ASPOR ATP-dependent RNA helicase drs1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=drs1 PE=3 SV=2 48 413 3.0E-48
sp|P24784|DBP1_YEAST ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP1 PE=1 SV=2 66 427 4.0E-48
sp|Q4P7Z8|DBP5_USTMA ATP-dependent RNA helicase DBP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP5 PE=3 SV=1 56 436 4.0E-48
sp|Q2U8K6|DBP5_ASPOR ATP-dependent RNA helicase dbp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp5 PE=3 SV=1 57 423 4.0E-48
sp|P09052|VASA1_DROME ATP-dependent RNA helicase vasa, isoform A OS=Drosophila melanogaster GN=vas PE=1 SV=3 62 426 4.0E-48
sp|A6ZWD3|DBP1_YEAS7 ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP1 PE=3 SV=1 66 427 4.0E-48
sp|Q6C799|DBP8_YARLI ATP-dependent RNA helicase DBP8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP8 PE=3 SV=1 57 426 4.0E-48
sp|Q0JL73|RH26_ORYSJ DEAD-box ATP-dependent RNA helicase 26 OS=Oryza sativa subsp. japonica GN=Os01g0618500 PE=2 SV=1 23 394 5.0E-48
sp|Q1EB85|DBP5_COCIM ATP-dependent RNA helicase DBP5 OS=Coccidioides immitis (strain RS) GN=DBP5 PE=3 SV=1 57 419 6.0E-48
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 50 418 6.0E-48
sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 43 404 7.0E-48
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 56 404 7.0E-48
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 66 426 7.0E-48
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 55 435 8.0E-48
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 57 418 8.0E-48
sp|A4R8G3|DBP8_MAGO7 ATP-dependent RNA helicase DBP8 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP8 PE=3 SV=3 53 437 8.0E-48
sp|Q0CDT1|DBP5_ASPTN ATP-dependent RNA helicase dbp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp5 PE=3 SV=1 57 423 9.0E-48
sp|A5E058|PRP5_LODEL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP5 PE=3 SV=1 61 411 9.0E-48
sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 57 427 9.0E-48
sp|Q088J2|RHLB_SHEFN ATP-dependent RNA helicase RhlB OS=Shewanella frigidimarina (strain NCIMB 400) GN=rhlB PE=3 SV=1 57 424 1.0E-47
sp|Q0UCB9|DBP5_PHANO ATP-dependent RNA helicase DBP5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP5 PE=3 SV=1 68 423 1.0E-47
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 74 404 1.0E-47
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 74 426 2.0E-47
sp|A2QFL3|DBP3_ASPNC ATP-dependent RNA helicase dbp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp3 PE=3 SV=1 75 409 2.0E-47
sp|P0CR02|DBP8_CRYNJ ATP-dependent RNA helicase DBP8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP8 PE=3 SV=1 11 426 2.0E-47
sp|Q6CEB8|DRS1_YARLI ATP-dependent RNA helicase DRS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DRS1 PE=3 SV=1 52 414 2.0E-47
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 74 426 2.0E-47
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 66 423 3.0E-47
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 56 426 3.0E-47
sp|Q6BY27|DBP2_DEBHA ATP-dependent RNA helicase DBP2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP2 PE=3 SV=1 40 409 3.0E-47
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRP3 PE=3 SV=1 56 425 3.0E-47
sp|Q54QS3|DDX3_DICDI Probable ATP-dependent RNA helicase ddx3 OS=Dictyostelium discoideum GN=ddx3 PE=3 SV=1 55 427 3.0E-47
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 43 427 4.0E-47
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 24 428 5.0E-47
sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 57 416 5.0E-47
sp|Q9C551|RH5_ARATH DEAD-box ATP-dependent RNA helicase 5 OS=Arabidopsis thaliana GN=RH5 PE=1 SV=1 72 404 5.0E-47
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 74 428 5.0E-47
sp|A7TK63|DBP8_VANPO ATP-dependent RNA helicase DBP8 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP8 PE=3 SV=1 57 428 5.0E-47
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 54 413 5.0E-47
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 65 416 6.0E-47
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 74 426 6.0E-47
sp|Q10202|DBP3_SCHPO ATP-dependent RNA helicase dbp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp3 PE=3 SV=1 5 428 7.0E-47
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 57 420 7.0E-47
sp|Q9FFQ1|RH31_ARATH DEAD-box ATP-dependent RNA helicase 31 OS=Arabidopsis thaliana GN=RH31 PE=2 SV=2 55 413 8.0E-47
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 43 428 8.0E-47
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 38 428 8.0E-47
sp|Q5AJD0|DBP5_CANAL ATP-dependent RNA helicase DBP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP5 PE=3 SV=1 57 419 8.0E-47
sp|Q59PR3|DBP8_CANAL ATP-dependent RNA helicase DBP8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP8 PE=3 SV=1 56 421 9.0E-47
sp|Q3MSQ8|DDX4_PELLE Probable ATP-dependent RNA helicase DDX4 OS=Pelophylax lessonae GN=ddx4 PE=2 SV=1 43 427 1.0E-46
sp|A6QXC1|DBP3_AJECN ATP-dependent RNA helicase DBP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP3 PE=3 SV=1 75 407 1.0E-46
sp|Q2HGF7|DBP5_CHAGB ATP-dependent RNA helicase DBP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP5 PE=3 SV=1 11 434 1.0E-46
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 24 426 1.0E-46
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 74 426 1.0E-46
sp|A6RW79|PRP5_BOTFB Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Botryotinia fuckeliana (strain B05.10) GN=prp5 PE=3 SV=1 67 427 1.0E-46
sp|A0KS84|RHLB_SHESA ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain ANA-3) GN=rhlB PE=3 SV=1 57 402 1.0E-46
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 62 424 1.0E-46
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 46 417 2.0E-46
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 74 426 2.0E-46
sp|Q09747|DBP5_SCHPO ATP-dependent RNA helicase dbp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp5 PE=1 SV=1 75 429 2.0E-46
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 57 413 2.0E-46
sp|Q4I830|DRS1_GIBZE ATP-dependent RNA helicase DRS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DRS1 PE=3 SV=1 41 413 2.0E-46
sp|Q6LLL5|RHLB_PHOPR ATP-dependent RNA helicase RhlB OS=Photobacterium profundum GN=rhlB PE=3 SV=1 57 424 2.0E-46
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 70 407 3.0E-46
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 61 409 3.0E-46
sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 56 434 3.0E-46
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 74 426 3.0E-46
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 74 428 3.0E-46
sp|P0CR03|DBP8_CRYNB ATP-dependent RNA helicase DBP8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP8 PE=3 SV=1 11 426 3.0E-46
sp|A2QAX7|DRS1_ASPNC ATP-dependent RNA helicase drs1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=drs1 PE=3 SV=1 57 413 3.0E-46
sp|A1D6X9|DBP8_NEOFI ATP-dependent RNA helicase dbp8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp8 PE=3 SV=1 54 432 3.0E-46
sp|A9L5D5|RHLB_SHEB9 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS195) GN=rhlB PE=3 SV=1 57 402 3.0E-46
sp|A6WTD3|RHLB_SHEB8 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS185) GN=rhlB PE=3 SV=1 57 402 3.0E-46
sp|A3D9I5|RHLB_SHEB5 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rhlB PE=3 SV=1 57 402 4.0E-46
sp|B8E670|RHLB_SHEB2 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS223) GN=rhlB PE=3 SV=1 57 402 4.0E-46
sp|A6SFW7|DBP2_BOTFB ATP-dependent RNA helicase dbp2 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp2 PE=3 SV=2 24 410 4.0E-46
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 74 428 4.0E-46
sp|Q6BML1|PRP5_DEBHA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP5 PE=3 SV=2 71 411 4.0E-46
sp|A7E449|DBP2_SCLS1 ATP-dependent RNA helicase dbp2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp2 PE=3 SV=1 24 410 4.0E-46
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 57 416 5.0E-46
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0016787 hydrolase activity Yes
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10869
MSHEEDLIDYSDEEIGANDSAPAPGAAAGSNGKKAELAAGNDVDKKGSYVGIHSTGFRDFLLKPELLRAIGDCGF
EHPSEVQQTCIPQALLGGDIICQAKSGLGKTAVFVLATLQQVEPVNGEVSVVVMCHTRELAYQIRDEYNRFSKYM
PDIKTGVFYGGTPIKTDVETLKNKDTCPHIIVGTPGRLKALVRDKALRLGSVRIFVLDECDKMLDQPDMRTDVQD
VFRATPQQKQVMMFSATLSETIKPICRKFMQNPTEHYVDEDTKLTLHGLQQYFIKLEEKEKNRKLNELLDDLQFN
QVIIFVRSTIRATELDKLLRECNFPSIAVHSGVSQEERIKRYKEFKEFKKRICVATDVFGRGIDIERINLAINYD
LPGDASSYLHRVGRAGRFGTKGLAISFVSSDQDQEVLKEIEKRFEVALPEFPKEGVDASTYMAS*
Coding >Hirsu2|10869
ATGTCTCACGAGGAGGATCTCATCGACTACTCCGATGAGGAGATCGGAGCCAACGACTCGGCGCCCGCCCCCGGG
GCCGCCGCCGGCTCCAACGGCAAGAAGGCCGAGCTGGCTGCCGGCAACGACGTCGACAAGAAGGGCAGCTACGTC
GGCATCCACTCGACCGGCTTCCGCGACTTTCTCCTGAAGCCCGAGCTTCTCCGCGCGATTGGCGACTGCGGTTTC
GAGCATCCATCGGAGGTCCAGCAAACCTGCATTCCTCAGGCCCTCCTCGGTGGCGACATCATCTGTCAGGCCAAG
TCGGGCCTGGGAAAGACGGCCGTCTTCGTCCTCGCCACGCTCCAGCAGGTGGAGCCCGTCAACGGCGAGGTGTCG
GTCGTCGTCATGTGCCACACCCGCGAGCTGGCCTATCAGATCCGTGACGAGTACAACCGATTCAGCAAGTACATG
CCCGACATCAAGACGGGCGTCTTCTACGGCGGCACCCCCATCAAGACGGACGTGGAGACGCTCAAGAACAAGGAC
ACTTGCCCCCACATCATCGTCGGCACCCCGGGCCGCCTCAAGGCCCTCGTCCGCGACAAGGCGCTCCGCCTGGGG
AGCGTCCGCATCTTCGTCTTGGACGAGTGCGACAAGATGCTCGACCAGCCCGACATGCGCACCGACGTCCAGGAC
GTGTTCCGCGCCACGCCCCAGCAGAAGCAGGTCATGATGTTCTCCGCCACGCTGTCGGAGACGATCAAGCCCATC
TGCCGGAAGTTCATGCAGAACCCGACGGAGCACTACGTCGACGAGGACACCAAGCTCACCCTGCACGGCCTCCAG
CAGTACTTCATCAAGCTGGAGGAGAAGGAGAAGAACCGCAAGCTCAACGAGCTGCTCGACGACCTGCAGTTCAAC
CAGGTCATCATCTTCGTGAGGAGCACCATCCGCGCGACGGAGCTCGACAAGCTCCTCCGCGAGTGCAACTTCCCC
TCCATCGCCGTCCACTCGGGCGTGAGCCAAGAGGAACGGATCAAGCGTTACAAGGAGTTCAAGGAGTTCAAGAAG
CGCATCTGCGTCGCGACCGACGTCTTCGGCCGAGGCATCGACATCGAGCGCATCAATCTGGCCATCAACTATGAC
CTCCCGGGCGACGCCAGCTCGTACCTGCACCGCGTCGGTCGTGCCGGCCGCTTCGGCACCAAGGGTCTGGCCATC
TCCTTCGTCAGCAGCGACCAGGACCAGGAGGTGCTGAAGGAGATCGAGAAGCGCTTCGAGGTTGCGCTGCCCGAG
TTTCCTAAGGAGGGCGTCGACGCCAGCACGTACATGGCGTCGTAG
Transcript >Hirsu2|10869
ATGTCTCACGAGGAGGATCTCATCGACTACTCCGATGAGGAGATCGGAGCCAACGACTCGGCGCCCGCCCCCGGG
GCCGCCGCCGGCTCCAACGGCAAGAAGGCCGAGCTGGCTGCCGGCAACGACGTCGACAAGAAGGGCAGCTACGTC
GGCATCCACTCGACCGGCTTCCGCGACTTTCTCCTGAAGCCCGAGCTTCTCCGCGCGATTGGCGACTGCGGTTTC
GAGCATCCATCGGAGGTCCAGCAAACCTGCATTCCTCAGGCCCTCCTCGGTGGCGACATCATCTGTCAGGCCAAG
TCGGGCCTGGGAAAGACGGCCGTCTTCGTCCTCGCCACGCTCCAGCAGGTGGAGCCCGTCAACGGCGAGGTGTCG
GTCGTCGTCATGTGCCACACCCGCGAGCTGGCCTATCAGATCCGTGACGAGTACAACCGATTCAGCAAGTACATG
CCCGACATCAAGACGGGCGTCTTCTACGGCGGCACCCCCATCAAGACGGACGTGGAGACGCTCAAGAACAAGGAC
ACTTGCCCCCACATCATCGTCGGCACCCCGGGCCGCCTCAAGGCCCTCGTCCGCGACAAGGCGCTCCGCCTGGGG
AGCGTCCGCATCTTCGTCTTGGACGAGTGCGACAAGATGCTCGACCAGCCCGACATGCGCACCGACGTCCAGGAC
GTGTTCCGCGCCACGCCCCAGCAGAAGCAGGTCATGATGTTCTCCGCCACGCTGTCGGAGACGATCAAGCCCATC
TGCCGGAAGTTCATGCAGAACCCGACGGAGCACTACGTCGACGAGGACACCAAGCTCACCCTGCACGGCCTCCAG
CAGTACTTCATCAAGCTGGAGGAGAAGGAGAAGAACCGCAAGCTCAACGAGCTGCTCGACGACCTGCAGTTCAAC
CAGGTCATCATCTTCGTGAGGAGCACCATCCGCGCGACGGAGCTCGACAAGCTCCTCCGCGAGTGCAACTTCCCC
TCCATCGCCGTCCACTCGGGCGTGAGCCAAGAGGAACGGATCAAGCGTTACAAGGAGTTCAAGGAGTTCAAGAAG
CGCATCTGCGTCGCGACCGACGTCTTCGGCCGAGGCATCGACATCGAGCGCATCAATCTGGCCATCAACTATGAC
CTCCCGGGCGACGCCAGCTCGTACCTGCACCGCGTCGGTCGTGCCGGCCGCTTCGGCACCAAGGGTCTGGCCATC
TCCTTCGTCAGCAGCGACCAGGACCAGGAGGTGCTGAAGGAGATCGAGAAGCGCTTCGAGGTTGCGCTGCCCGAG
TTTCCTAAGGAGGGCGTCGACGCCAGCACGTACATGGCGTCGTAG
Gene >Hirsu2|10869
ATGTCTCACGAGGAGGATCTCATCGACTACTCCGATGAGGAGATCGGAGCCAACGACTCGGCGCCCGCCCCCGGG
GCCGCCGCCGGCTCCAACGGCAAGAAGGCCGAGCTGGCTGCCGGCAACGACGTCGACAAGAAGGGCAGCTACGTC
GGCATCCACTCGACCGGCTTCCGCGACTTTCTCCTGAAGCCCGAGCTTCTCCGCGCGATTGGCGACTGCGGTTTC
GAGCATCCATCGGAGGGTCAGTCCTGAAATGCATTCCAATTACTCCCCAACTCTTTCAGTTCCCCTCCCTGCAGC
CGTCCGTCCATCTCGCACGAGCGCCGTGCGACGCTTCCGCCGCCGTCGATCAGAAATCCCTTTCCCCCCCGCCTC
CCTCCTCTGCCACCTCTATTCTTCCGCCGCCCGAGGAATACGGCCGGCCTTCTGGCAACCCTGCCCGTCTTCTGA
CGGCGACCGGCACCGATGGGACGAGAAGGGGTGGACCCTTTGAGACCTCGGTCACCCTGACGTGTTTTGTTTTTC
CCCCTTCCCACCCCTCGGAGGACGGCGGGACCCGCAAGCTTGCACACGAAGGCGACCTCTTCTGTGACGGACGCC
ATCGACTCTTGCTTGTCTTCTGTCGGTCCTCCTGTCGACGGACAATGGTGACGAGGCTACGCGGGGGCCGCACGC
GTGGCTGGCGCCGTGCGGCCTGGTTCCCCATCTCTCTCGCCCCAAAGCTCCTCGAGCTGGGCCGCATATCTCTTC
GGAGTTGCAAGAGATGGAGCCTTGAGCTGGAGGCGAGCGGCATCACTGCTGGAACCGGTCGACCTGCCTTTCCCT
CTCTTCGAAACACACCGACGCGCTCGCGCGGCCCACGGTCGCTTCGCTGCCGTGATGGACGGACGGACGAACCCC
TTGCCGCAGCACTGCACAAACATCGCCCGTTACTCTGTGGAACTTTTTTTTTTGATCTGACATCCGCTTCCAACA
ACAGTCCAGCAAACCTGCATTCCTCAGGCCCTCCTCGGTGGCGACATCATCTGTCAGGCCAAGTCGGGCCTGGGA
AAGACGGCCGTCTTCGTCCTCGCCACGCTCCAGCAGGTGGAGCCCGTCAACGGCGAGGTGTCGGTCGTCGTCATG
TGCCACACCCGCGAGCTGGCCTATCAGATCCGTGACGAGTACAACCGATTCAGCAAGTACATGCCCGACATCAAG
ACGGGCGTCTTCTACGGCGGCACCCCCATCAAGACGGACGTGGAGACGCTCAAGAACAAGGACACTTGCCCCCAC
ATCATCGTCGGCACCCCGGGCCGCCTCAAGGCCCTCGTCCGCGACAAGGCGCTCCGCCTGGGGAGCGTCCGCATC
TTCGTCTTGGACGAGTGCGACAAGATGCTCGACCAGCCCGGTGAGCCTCCCTTCGCTTCCGCCGCCCGCAAGCCC
GCACGCACGCACGACTGACTCCGAAGCCAGACATGCGCACCGACGTCCAGGACGTGTTCCGCGCCACGCCCCAGC
AGAAGCAGGTCATGATGTTCTCCGCCACGCTGTCGGAGACGATCAAGCCCATCTGCCGGAAGTTCATGCAGAACC
CGACGGAGCACTACGTCGACGAGGACACCAAGCTCACCCTGCACGGCCTCCAGCAGTACTTCATCAAGCTGGAGG
AGAAGGAGAAGAACCGCAAGCTCAACGAGCTGCTCGACGACCTGCAGTTCAACCAGGTCATCATCTTCGTGAGGA
GCACCATCCGCGCGACGGAGCTCGACAAGCTCCTCCGCGAGTGCAACTTCCCCTCCATCGCCGTCCACTCGGGCG
TGAGCCAAGAGGAACGGTCAGTCCGGCCCGTCGTCGCGTCACCGCTCGTCCCCCGTCCGCTCGCTGACCATCGTC
CCAACGTGCAGGATCAAGCGTTACAAGGAGTTCAAGGAGTTCAAGAAGCGCATCTGCGTCGCGACCGACGTCTTC
GGCCGAGGCATCGACATCGAGCGCATCAATCTGGCCATCAACTATGACCTCCCGGGCGACGCCAGCTCGTACCTG
CACCGCGTCGGTCGTGCCGGCCGCTTCGGCACCAAGGGTCTGGCCATCTCCTTCGTCAGCAGCGACCAGGACCAG
GAGGTGCTGAAGGAGATCGAGAAGCGCTTCGAGGTTGCGCTGCCGTGAGTCCTCCCCGACCCCGAAAGCGCGTTC
GACGATTAACAGTTGTCAACCTGCAGCGAGTTTCCTAAGGAGGGCGTCGACGCCAGCACGTACATGGCGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail