Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10866
Gene name
LocationContig_917:5080..6709
Strand+
Gene length (bp)1629
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 1.5E-44 95 263

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WI46|CRF2_ASPFU Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=1 20 375 5.0E-130
sp|Q5AJC0|UTR2_CANAL Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTR2 PE=1 SV=1 2 371 2.0E-112
sp|P32623|CRH2_YEAST Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTR2 PE=1 SV=3 18 342 2.0E-107
sp|Q05790|CRR1_YEAST Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRR1 PE=2 SV=1 6 292 1.0E-65
sp|Q75A41|CRR1_ASHGO Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CRR1 PE=3 SV=1 1 293 2.0E-62
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WI46|CRF2_ASPFU Probable glycosidase crf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=1 20 375 5.0E-130
sp|Q5AJC0|UTR2_CANAL Extracellular glycosidase UTR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UTR2 PE=1 SV=1 2 371 2.0E-112
sp|P32623|CRH2_YEAST Probable glycosidase CRH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTR2 PE=1 SV=3 18 342 2.0E-107
sp|Q05790|CRR1_YEAST Probable glycosidase CRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRR1 PE=2 SV=1 6 292 1.0E-65
sp|Q75A41|CRR1_ASHGO Probable glycosidase CRR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CRR1 PE=3 SV=1 1 293 2.0E-62
sp|D4B4J2|CRH12_ARTBC Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03382 PE=3 SV=2 105 323 1.0E-33
sp|Q8J0P4|CRF1_ASPFU Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=crf1 PE=1 SV=2 110 316 6.0E-27
sp|D4ALQ5|CRH11_ARTBC Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05253 PE=1 SV=2 110 269 9.0E-25
sp|Q5AFA2|CRH11_CANAL Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH11 PE=1 SV=1 108 269 1.0E-23
sp|P53301|CRH1_YEAST Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRH1 PE=1 SV=1 99 270 7.0E-23
sp|Q5AK54|CRH12_CANAL Extracellular glycosidase CRH12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRH12 PE=1 SV=1 108 265 4.0E-16
sp|P27051|GUB_BACLI Beta-glucanase OS=Bacillus licheniformis GN=bg1 PE=1 SV=1 129 264 4.0E-14
sp|Q84C00|GUB_CLOTM Beta-glucanase OS=Clostridium thermocellum GN=licB PE=1 SV=1 103 264 3.0E-13
sp|P04957|GUB_BACSU Beta-glucanase OS=Bacillus subtilis (strain 168) GN=bglS PE=1 SV=2 129 264 1.0E-12
sp|A3DBX3|GUB_CLOTH Beta-glucanase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=licB PE=1 SV=1 102 250 2.0E-12
sp|P07980|GUB_BACAM Beta-glucanase OS=Bacillus amyloliquefaciens GN=bglA PE=3 SV=1 129 250 4.0E-12
sp|P45797|GUB_PAEPO Beta-glucanase OS=Paenibacillus polymyxa GN=gluB PE=3 SV=1 129 250 8.0E-11
sp|P23904|GUB_PAEMA Beta-glucanase OS=Paenibacillus macerans PE=1 SV=2 54 250 8.0E-11
sp|P37073|GUB_BREBE Beta-glucanase OS=Brevibacillus brevis GN=bglBB PE=1 SV=1 106 250 9.0E-09
sp|O14412|GUB_ORPSP Beta-glucanase OS=Orpinomyces sp. (strain PC-2) GN=licA PE=1 SV=1 103 250 2.0E-08
sp|Q9SVV2|XTH26_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 26 OS=Arabidopsis thaliana GN=XTH26 PE=2 SV=1 103 215 1.0E-07
sp|Q38910|XTH23_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 23 OS=Arabidopsis thaliana GN=XTH23 PE=2 SV=1 109 248 4.0E-07
sp|Q38907|XTH25_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 25 OS=Arabidopsis thaliana GN=XTH25 PE=2 SV=2 102 248 6.0E-07
sp|P35694|XTH2_SOYBN Xyloglucan endotransglucosylase/hydrolase 2 OS=Glycine max PE=2 SV=1 103 248 8.0E-07
sp|Q8LER3|XTH7_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 7 OS=Arabidopsis thaliana GN=XTH7 PE=2 SV=2 103 298 2.0E-06
sp|Q9SV61|XTH1_ARATH Putative xyloglucan endotransglucosylase/hydrolase protein 1 OS=Arabidopsis thaliana GN=XTH1 PE=3 SV=2 129 250 4.0E-06
sp|Q9M0D1|XTH19_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 19 OS=Arabidopsis thaliana GN=XTH19 PE=2 SV=1 118 248 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10866
MVRFAALAALVGAGTALATKCSLSSKCPRDAPCCSQYGECGTGAYCLGGCDPRMSFSLEACVPAPVCRSARRRFE
TLDGVVDIGKYLGDASAADWVAQGEPALHGGNLLLTMAKDSVGTVLASTSYMWYGSVRARLKTSRGRGVVTAFIL
LSDVKDEIDYEFVGVDLQTAQTNYYFQGVPDYHNSGNISLSDTFRNFHDYEIRWTPDKIEWLVDGQLGRSKLRRD
TWNETTQQWQFPQTPARVQLSVWPGGLASNAKGTIQWAGGEIDWDADDVRSAGYFYATVAEVEMDCYDAPGRAGP
GSHAGKSYTYSAARGTNDTVVDGDRPTVLGSLDATGLDMDKGKKKQQQQQQQSSSASSTLAADEPQRTQNTIPGG
GATRFQGQDHSGQAKGGSPGGDTDANGSGQDGGQAGCDSKSFSQSCGASTNENGSSNGKNSNGGKSGGAKTSASA
FAMIIAATALFWM*
Coding >Hirsu2|10866
ATGGTGCGCTTCGCCGCGCTCGCCGCGCTCGTGGGCGCCGGCACCGCTCTGGCGACCAAGTGCTCGCTGAGCAGC
AAATGCCCACGGGACGCTCCCTGTTGCTCGCAATACGGCGAGTGCGGAACGGGCGCGTACTGCCTCGGCGGCTGC
GACCCGCGCATGTCCTTCTCGCTGGAGGCGTGCGTGCCGGCGCCGGTGTGCCGCAGCGCGCGGCGCCGGTTCGAG
ACGCTGGACGGCGTCGTCGACATCGGCAAGTACCTGGGCGACGCCTCGGCGGCCGACTGGGTGGCGCAGGGCGAG
CCGGCCCTGCACGGCGGCAACCTGCTGCTGACCATGGCCAAGGACAGCGTCGGCACCGTCCTGGCCTCGACGTCG
TACATGTGGTACGGCAGCGTGCGGGCCCGGCTGAAGACGAGCCGCGGCCGTGGCGTCGTCACCGCCTTCATCCTG
CTGTCCGACGTCAAGGACGAGATCGACTATGAGTTCGTCGGCGTCGACCTGCAGACGGCCCAGACCAACTACTAC
TTCCAGGGCGTGCCCGACTACCACAACTCGGGCAACATCTCGCTGTCGGACACGTTCCGCAACTTCCACGACTAC
GAGATCCGCTGGACGCCCGACAAGATCGAGTGGCTCGTCGACGGCCAGCTGGGCCGGTCCAAGCTACGCCGGGAC
ACGTGGAACGAGACGACGCAGCAGTGGCAGTTCCCCCAGACGCCCGCCCGCGTCCAGCTGTCCGTCTGGCCCGGC
GGCCTGGCCTCCAACGCCAAGGGCACCATCCAGTGGGCCGGCGGCGAGATCGACTGGGACGCCGACGACGTCCGC
TCCGCCGGCTACTTCTACGCCACCGTCGCCGAGGTCGAGATGGACTGCTACGACGCCCCCGGCCGCGCCGGGCCC
GGCTCCCACGCCGGCAAGAGCTACACGTACAGCGCCGCCCGCGGCACCAACGACACCGTCGTCGACGGCGACCGG
CCCACCGTCCTCGGCTCCCTCGACGCCACCGGCCTCGACATGGACAAGGGCAAGAAGAAGCAGCAGCAGCAGCAG
CAGCAGTCGTCCTCGGCCTCGTCCACCCTGGCCGCCGACGAGCCGCAGCGGACGCAGAACACGATCCCCGGCGGC
GGCGCCACCCGCTTCCAGGGCCAGGACCACAGCGGCCAGGCCAAGGGCGGCAGCCCCGGCGGCGACACCGACGCC
AACGGCTCCGGCCAGGACGGCGGCCAGGCCGGCTGCGACTCCAAGAGCTTCAGCCAGAGCTGCGGCGCCTCCACC
AACGAAAACGGCAGCAGCAACGGCAAGAACAGCAACGGCGGCAAGAGTGGCGGCGCCAAGACCAGCGCCAGCGCC
TTTGCCATGATCATCGCCGCCACCGCCCTGTTCTGGATGTAG
Transcript >Hirsu2|10866
ATGGTGCGCTTCGCCGCGCTCGCCGCGCTCGTGGGCGCCGGCACCGCTCTGGCGACCAAGTGCTCGCTGAGCAGC
AAATGCCCACGGGACGCTCCCTGTTGCTCGCAATACGGCGAGTGCGGAACGGGCGCGTACTGCCTCGGCGGCTGC
GACCCGCGCATGTCCTTCTCGCTGGAGGCGTGCGTGCCGGCGCCGGTGTGCCGCAGCGCGCGGCGCCGGTTCGAG
ACGCTGGACGGCGTCGTCGACATCGGCAAGTACCTGGGCGACGCCTCGGCGGCCGACTGGGTGGCGCAGGGCGAG
CCGGCCCTGCACGGCGGCAACCTGCTGCTGACCATGGCCAAGGACAGCGTCGGCACCGTCCTGGCCTCGACGTCG
TACATGTGGTACGGCAGCGTGCGGGCCCGGCTGAAGACGAGCCGCGGCCGTGGCGTCGTCACCGCCTTCATCCTG
CTGTCCGACGTCAAGGACGAGATCGACTATGAGTTCGTCGGCGTCGACCTGCAGACGGCCCAGACCAACTACTAC
TTCCAGGGCGTGCCCGACTACCACAACTCGGGCAACATCTCGCTGTCGGACACGTTCCGCAACTTCCACGACTAC
GAGATCCGCTGGACGCCCGACAAGATCGAGTGGCTCGTCGACGGCCAGCTGGGCCGGTCCAAGCTACGCCGGGAC
ACGTGGAACGAGACGACGCAGCAGTGGCAGTTCCCCCAGACGCCCGCCCGCGTCCAGCTGTCCGTCTGGCCCGGC
GGCCTGGCCTCCAACGCCAAGGGCACCATCCAGTGGGCCGGCGGCGAGATCGACTGGGACGCCGACGACGTCCGC
TCCGCCGGCTACTTCTACGCCACCGTCGCCGAGGTCGAGATGGACTGCTACGACGCCCCCGGCCGCGCCGGGCCC
GGCTCCCACGCCGGCAAGAGCTACACGTACAGCGCCGCCCGCGGCACCAACGACACCGTCGTCGACGGCGACCGG
CCCACCGTCCTCGGCTCCCTCGACGCCACCGGCCTCGACATGGACAAGGGCAAGAAGAAGCAGCAGCAGCAGCAG
CAGCAGTCGTCCTCGGCCTCGTCCACCCTGGCCGCCGACGAGCCGCAGCGGACGCAGAACACGATCCCCGGCGGC
GGCGCCACCCGCTTCCAGGGCCAGGACCACAGCGGCCAGGCCAAGGGCGGCAGCCCCGGCGGCGACACCGACGCC
AACGGCTCCGGCCAGGACGGCGGCCAGGCCGGCTGCGACTCCAAGAGCTTCAGCCAGAGCTGCGGCGCCTCCACC
AACGAAAACGGCAGCAGCAACGGCAAGAACAGCAACGGCGGCAAGAGTGGCGGCGCCAAGACCAGCGCCAGCGCC
TTTGCCATGATCATCGCCGCCACCGCCCTGTTCTGGATGTAG
Gene >Hirsu2|10866
ATGGTGCGCTTCGCCGCGCTCGCCGCGCTCGTGGGCGCCGGCACCGCTCTGGCGACCAAGTGCTCGCTGAGCAGC
AAATGCCCACGGGACGCTCCCTGTTGCTCGCGTGAGTCCCCGTTCCCCTTGCTCCCGTACGCACACACACATTTT
TTCTTCTTCACTGTCTCATGGTGGCGGAGAGTGAGCTGTGTGTGTGTGTGTGTGTCTGTGATCGTTTGTTAGAGA
AAAAATGGAGGACGGTAGCTGACAGCTGTTTTTCCATGCTCGATGCTTCGCGCAGAATACGGCGAGTGCGGAACG
GGCGCGTACTGCCTCGGCGGCTGCGACCCGCGCATGTCCTTCTCGCTGGAGGCGTGCGTGCCGGCGCCGGTGTGC
CGCAGCGCGCGGCGCCGGTTCGAGACGCTGGACGGCGTCGTCGACATCGGCAAGTACCTGGGCGACGCCTCGGCG
GCCGACTGGGTGGCGCAGGGCGAGCCGGCCCTGCACGGCGGCAACCTGCTGCTGACCATGGCCAAGGACAGCGTC
GGCACCGTCCTGGCCTCGACGTCGTACATGTGGTACGGCAGCGTGCGGGCCCGGCTGAAGACGAGCCGCGGCCGT
GGCGTCGTCACCGCCTTCATCCTGCTGTCCGACGTCAAGGACGAGATCGACTATGAGTTCGTCGGCGTCGACCTG
CAGACGGCCCAGACCAACTACTACTTCCAGGGCGTGCCCGACTGTGAGTCCATCCCCCCCCGGGACGCGTGGATG
ACGGGCTGACGGGTGGCCGCCTACGGGCCAGACCACAACTCGGGCAACATCTCGCTGTCGGACACGTTCCGCAAC
TTCCACGACTACGAGATCCGCTGGACGCCCGACAAGATCGAGTGGCTCGTCGACGGCCAGCTGGGCCGGTCCAAG
CTACGCCGGGACACGTGGAACGAGACGACGCAGCAGTGGCAGTTCCCCCAGACGCCCGCCCGCGTCCAGCTGTCC
GTCTGGCCCGGCGGCCTGGCCTCCAACGCCAAGGGCACCATCCAGTGGGCCGGCGGCGAGATCGACTGGGACGCC
GACGACGTCCGCTCCGCCGGCTACTTCTACGCCACCGTCGCCGAGGTCGAGATGGACTGCTACGACGCCCCCGGC
CGCGCCGGGCCCGGCTCCCACGCCGGCAAGAGCTACACGTACAGCGCCGCCCGCGGCACCAACGACACCGTCGTC
GACGGCGACCGGCCCACCGTCCTCGGCTCCCTCGACGCCACCGGCCTCGACATGGACAAGGGCAAGAAGAAGCAG
CAGCAGCAGCAGCAGCAGTCGTCCTCGGCCTCGTCCACCCTGGCCGCCGACGAGCCGCAGCGGACGCAGAACACG
ATCCCCGGCGGCGGCGCCACCCGCTTCCAGGGCCAGGACCACAGCGGCCAGGCCAAGGGCGGCAGCCCCGGCGGC
GACACCGACGCCAACGGCTCCGGCCAGGACGGCGGCCAGGCCGGCTGCGACTCCAAGAGCTTCAGCCAGAGCTGC
GGCGCCTCCACCAACGAAAACGGCAGCAGCAACGGCAAGAACAGCAACGGCGGCAAGAGTGGCGGCGCCAAGACC
AGCGCCAGCGCCTTTGCCATGATCATCGCCGCCACCGCCCTGTTCTGGATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail