Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10865
Gene name
LocationContig_917:1271..3394
Strand+
Gene length (bp)2123
Transcript length (bp)1848
Coding sequence length (bp)1848
Protein length (aa) 616

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 3.4E-39 55 227
PF00271 Helicase_C Helicase conserved C-terminal domain 3.5E-28 268 425
PF04851 ResIII Type III restriction enzyme, res subunit 2.3E-06 68 190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IJ56|DBP9_GIBZE ATP-dependent RNA helicase DBP9 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP9 PE=3 SV=1 2 615 0.0E+00
sp|A6SNX1|DBP9_BOTFB ATP-dependent RNA helicase dbp9 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp9 PE=3 SV=2 1 613 0.0E+00
sp|A4QTR1|DBP9_MAGO7 ATP-dependent RNA helicase DBP9 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP9 PE=3 SV=1 34 615 0.0E+00
sp|A7EM78|DBP9_SCLS1 ATP-dependent RNA helicase dbp9 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp9 PE=3 SV=1 1 613 0.0E+00
sp|A1DHV3|DBP9_NEOFI ATP-dependent RNA helicase dbp9 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp9 PE=3 SV=1 1 613 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IJ56|DBP9_GIBZE ATP-dependent RNA helicase DBP9 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP9 PE=3 SV=1 2 615 0.0E+00
sp|A6SNX1|DBP9_BOTFB ATP-dependent RNA helicase dbp9 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp9 PE=3 SV=2 1 613 0.0E+00
sp|A4QTR1|DBP9_MAGO7 ATP-dependent RNA helicase DBP9 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP9 PE=3 SV=1 34 615 0.0E+00
sp|A7EM78|DBP9_SCLS1 ATP-dependent RNA helicase dbp9 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp9 PE=3 SV=1 1 613 0.0E+00
sp|A1DHV3|DBP9_NEOFI ATP-dependent RNA helicase dbp9 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp9 PE=3 SV=1 1 613 0.0E+00
sp|Q0CY48|DBP9_ASPTN ATP-dependent RNA helicase dbp9 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp9 PE=3 SV=2 1 613 0.0E+00
sp|Q4X0C2|DBP9_ASPFU ATP-dependent RNA helicase dbp9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp9 PE=3 SV=1 1 613 0.0E+00
sp|Q7S6F3|DBP9_NEUCR ATP-dependent RNA helicase dbp-9 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-9 PE=3 SV=1 21 578 0.0E+00
sp|Q1DWF4|DBP9_COCIM ATP-dependent RNA helicase DBP9 OS=Coccidioides immitis (strain RS) GN=DBP9 PE=3 SV=2 1 611 0.0E+00
sp|Q2UFL0|DBP9_ASPOR ATP-dependent RNA helicase dbp9 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp9 PE=3 SV=1 1 613 0.0E+00
sp|A1C7F7|DBP9_ASPCL ATP-dependent RNA helicase dbp9 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp9 PE=3 SV=1 1 613 0.0E+00
sp|Q5AZA6|DBP9_EMENI ATP-dependent RNA helicase dbp9 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp9 PE=3 SV=1 1 613 0.0E+00
sp|A6R2L6|DBP9_AJECN ATP-dependent RNA helicase DBP9 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP9 PE=3 SV=1 1 610 0.0E+00
sp|A2QCW6|DBP9_ASPNC ATP-dependent RNA helicase dbp9 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp9 PE=3 SV=1 1 613 0.0E+00
sp|Q0UZ59|DBP9_PHANO ATP-dependent RNA helicase DBP9 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP9 PE=3 SV=1 1 615 0.0E+00
sp|Q6CUI6|DBP9_KLULA ATP-dependent RNA helicase DBP9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP9 PE=3 SV=1 27 609 0.0E+00
sp|Q74ZC1|DBP9_ASHGO ATP-dependent RNA helicase DBP9 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP9 PE=3 SV=1 18 609 0.0E+00
sp|Q5A4P9|DBP9_CANAL ATP-dependent RNA helicase DBP9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP9 PE=3 SV=1 27 609 0.0E+00
sp|Q6BLM5|DBP9_DEBHA ATP-dependent RNA helicase DBP9 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP9 PE=3 SV=1 26 611 0.0E+00
sp|A3LV40|DBP9_PICST ATP-dependent RNA helicase DBP9 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP9 PE=3 SV=1 26 612 0.0E+00
sp|Q06218|DBP9_YEAST ATP-dependent RNA helicase DBP9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP9 PE=1 SV=1 27 609 0.0E+00
sp|A7A1G0|DBP9_YEAS7 ATP-dependent RNA helicase DBP9 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP9 PE=3 SV=1 27 609 0.0E+00
sp|A5E572|DBP9_LODEL ATP-dependent RNA helicase DBP9 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP9 PE=3 SV=1 23 609 0.0E+00
sp|O60080|DBP9_SCHPO ATP-dependent RNA helicase dbp9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp9 PE=3 SV=1 24 609 0.0E+00
sp|Q6FUA6|DBP9_CANGA ATP-dependent RNA helicase DBP9 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP9 PE=3 SV=1 27 608 0.0E+00
sp|A7TPC9|DBP9_VANPO ATP-dependent RNA helicase DBP9 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP9 PE=3 SV=2 27 609 0.0E+00
sp|A5DC85|DBP9_PICGU ATP-dependent RNA helicase DBP9 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP9 PE=3 SV=2 13 572 4.0E-180
sp|Q6BZR4|DBP9_YARLI ATP-dependent RNA helicase DBP9 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP9 PE=3 SV=1 28 561 8.0E-166
sp|Q4P7M1|DBP9_USTMA ATP-dependent RNA helicase DBP9 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP9 PE=3 SV=1 23 608 2.0E-150
sp|Q9D0R4|DDX56_MOUSE Probable ATP-dependent RNA helicase DDX56 OS=Mus musculus GN=Ddx56 PE=2 SV=1 25 613 3.0E-139
sp|Q9NY93|DDX56_HUMAN Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens GN=DDX56 PE=1 SV=1 25 613 4.0E-138
sp|P0CR10|DBP9_CRYNJ ATP-dependent RNA helicase DBP9 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP9 PE=3 SV=1 37 558 2.0E-137
sp|P0CR11|DBP9_CRYNB ATP-dependent RNA helicase DBP9 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP9 PE=3 SV=1 37 558 2.0E-137
sp|Q3SZ40|DDX56_BOVIN Probable ATP-dependent RNA helicase DDX56 OS=Bos taurus GN=DDX56 PE=2 SV=1 25 611 5.0E-136
sp|Q6ATJ8|RH16_ORYSJ DEAD-box ATP-dependent RNA helicase 16 OS=Oryza sativa subsp. japonica GN=Os03g0728800 PE=2 SV=1 30 615 9.0E-115
sp|Q9SW44|RH16_ARATH DEAD-box ATP-dependent RNA helicase 16 OS=Arabidopsis thaliana GN=RH16 PE=2 SV=1 31 608 5.0E-113
sp|Q54VF1|DDX56_DICDI Probable ATP-dependent RNA helicase ddx56 OS=Dictyostelium discoideum GN=ddx56 PE=3 SV=1 31 352 6.0E-82
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 30 466 2.0E-51
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 30 466 2.0E-51
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 31 435 3.0E-51
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 31 541 7.0E-49
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 27 519 1.0E-48
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 31 435 9.0E-48
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 22 433 2.0E-46
sp|A1CNV8|DRS1_ASPCL ATP-dependent RNA helicase drs1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=drs1 PE=3 SV=1 20 433 2.0E-46
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 6 494 3.0E-46
sp|P33906|DEAD_KLEPN ATP-dependent RNA helicase DeaD OS=Klebsiella pneumoniae GN=deaD PE=3 SV=3 30 438 4.0E-46
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 21 434 5.0E-46
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 31 476 6.0E-46
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 19 499 8.0E-46
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 21 434 1.0E-45
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 25 434 1.0E-45
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 6 494 2.0E-45
sp|Q09903|DRS1_SCHPO ATP-dependent RNA helicase drs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=drs1 PE=3 SV=1 17 525 2.0E-45
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 32 439 4.0E-45
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 32 439 4.0E-45
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 30 434 4.0E-45
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 31 476 6.0E-45
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 14 439 7.0E-45
sp|Q8XA87|DEAD_ECO57 ATP-dependent RNA helicase DeaD OS=Escherichia coli O157:H7 GN=deaD PE=3 SV=3 27 438 7.0E-45
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 30 439 8.0E-45
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 12 494 9.0E-45
sp|Q4WRV2|DRS1_ASPFU ATP-dependent RNA helicase drs1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=drs1 PE=3 SV=1 31 498 1.0E-44
sp|A1D1R8|DRS1_NEOFI ATP-dependent RNA helicase drs1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=drs1 PE=3 SV=1 31 433 1.0E-44
sp|P0A9P8|DEAD_SHIFL ATP-dependent RNA helicase DeaD OS=Shigella flexneri GN=deaD PE=3 SV=2 27 438 1.0E-44
sp|P0A9P6|DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) GN=deaD PE=1 SV=2 27 438 1.0E-44
sp|P0A9P7|DEAD_ECOL6 ATP-dependent RNA helicase DeaD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=deaD PE=3 SV=2 27 438 1.0E-44
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 6 434 3.0E-44
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 28 438 3.0E-44
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 30 443 5.0E-44
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 20 494 6.0E-44
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 31 508 6.0E-44
sp|Q0CZN5|DRS1_ASPTN ATP-dependent RNA helicase drs1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=drs1 PE=3 SV=1 31 433 6.0E-44
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 31 494 8.0E-44
sp|Q4I830|DRS1_GIBZE ATP-dependent RNA helicase DRS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DRS1 PE=3 SV=1 30 486 1.0E-43
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 31 594 1.0E-43
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 31 499 2.0E-43
sp|P57453|DEAD_BUCAI ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=deaD PE=3 SV=1 26 438 3.0E-43
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 24 439 4.0E-43
sp|A2QAX7|DRS1_ASPNC ATP-dependent RNA helicase drs1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=drs1 PE=3 SV=1 15 433 1.0E-42
sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 30 440 1.0E-42
sp|Q4FZF3|DDX49_MOUSE Probable ATP-dependent RNA helicase DDX49 OS=Mus musculus GN=Ddx49 PE=2 SV=1 32 467 2.0E-42
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 23 494 2.0E-42
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 31 439 2.0E-42
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 30 434 2.0E-42
sp|Q8K9H6|DEAD_BUCAP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=deaD PE=3 SV=1 26 438 3.0E-42
sp|A6RUH2|DRS1_BOTFB ATP-dependent RNA helicase drs1 OS=Botryotinia fuckeliana (strain B05.10) GN=drs1 PE=3 SV=1 27 433 4.0E-42
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 31 439 5.0E-42
sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens GN=DDX49 PE=1 SV=1 32 443 7.0E-42
sp|A7F4L5|DRS1_SCLS1 ATP-dependent RNA helicase drs1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=drs1 PE=3 SV=1 27 433 7.0E-42
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 3 476 8.0E-42
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 21 434 8.0E-42
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 31 439 1.0E-41
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 31 439 1.0E-41
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 28 441 1.0E-41
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 28 441 1.0E-41
sp|P32892|DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS1 PE=1 SV=2 14 434 2.0E-41
sp|A7A0P8|DRS1_YEAS7 ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRS1 PE=3 SV=1 14 434 2.0E-41
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 27 434 3.0E-41
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 19 434 4.0E-41
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 31 439 4.0E-41
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 23 471 6.0E-41
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 23 471 6.0E-41
sp|Q8L4E9|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36 OS=Oryza sativa subsp. japonica GN=Os07g0633500 PE=3 SV=1 6 434 7.0E-41
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 5 433 8.0E-41
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 24 494 1.0E-40
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 22 494 1.0E-40
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 30 438 1.0E-40
sp|Q9Z6C9|CSHA_LACRE ATP-dependent RNA helicase CshA OS=Lactobacillus reuteri GN=cshA PE=3 SV=1 32 443 1.0E-40
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 31 439 1.0E-40
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 31 439 1.0E-40
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 31 439 1.0E-40
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 31 439 1.0E-40
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 31 439 1.0E-40
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 31 439 1.0E-40
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 31 439 1.0E-40
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 31 439 1.0E-40
sp|P0CQ96|SUB2_CRYNJ ATP-dependent RNA helicase SUB2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SUB2 PE=3 SV=1 11 461 1.0E-40
sp|P0CQ97|SUB2_CRYNB ATP-dependent RNA helicase SUB2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SUB2 PE=3 SV=1 11 461 1.0E-40
sp|Q9LFN6|RH56_ARATH DEAD-box ATP-dependent RNA helicase 56 OS=Arabidopsis thaliana GN=RH56 PE=1 SV=2 10 434 2.0E-40
sp|Q56XG6|RH15_ARATH DEAD-box ATP-dependent RNA helicase 15 OS=Arabidopsis thaliana GN=RH15 PE=1 SV=3 10 434 2.0E-40
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 30 438 2.0E-40
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 30 438 2.0E-40
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 30 438 2.0E-40
sp|Q9FNM7|RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana GN=RH26 PE=1 SV=2 1 440 2.0E-40
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 31 439 2.0E-40
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 30 438 2.0E-40
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 30 438 3.0E-40
sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2 23 524 3.0E-40
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 32 434 4.0E-40
sp|Q54CD8|DDX54_DICDI ATP-dependent RNA helicase ddx54 OS=Dictyostelium discoideum GN=helA PE=3 SV=1 32 439 4.0E-40
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 19 439 4.0E-40
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 31 434 5.0E-40
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 31 439 8.0E-40
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 28 434 1.0E-39
sp|A3LSN3|DRS1_PICST ATP-dependent RNA helicase DRS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRS1 PE=3 SV=3 22 434 1.0E-39
sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus GN=DDX27 PE=2 SV=1 23 434 1.0E-39
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 11 498 3.0E-39
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 31 434 3.0E-39
sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 31 438 4.0E-39
sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cshA PE=3 SV=1 31 438 4.0E-39
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 31 435 4.0E-39
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 31 438 5.0E-39
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 29 442 6.0E-39
sp|A5DY34|DRS1_LODEL ATP-dependent RNA helicase DRS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DRS1 PE=3 SV=1 31 434 6.0E-39
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 31 435 7.0E-39
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 27 434 7.0E-39
sp|Q6BP45|ROK1_DEBHA ATP-dependent RNA helicase ROK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ROK1 PE=3 SV=2 31 433 1.0E-38
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 32 438 2.0E-38
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 32 444 2.0E-38
sp|Q9Y7C4|ROK1_CANAL ATP-dependent RNA helicase CHR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHR1 PE=3 SV=1 31 433 2.0E-38
sp|Q756G5|DBP8_ASHGO ATP-dependent RNA helicase DBP8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP8 PE=3 SV=1 26 441 3.0E-38
sp|Q921N6|DDX27_MOUSE Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus GN=Ddx27 PE=1 SV=3 23 434 3.0E-38
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 31 439 3.0E-38
sp|O74393|MAK5_SCHPO ATP-dependent RNA helicase mak5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak5 PE=1 SV=1 30 439 4.0E-38
sp|Q810A7|DDX42_MOUSE ATP-dependent RNA helicase DDX42 OS=Mus musculus GN=Ddx42 PE=1 SV=3 30 438 4.0E-38
sp|Q86XP3|DDX42_HUMAN ATP-dependent RNA helicase DDX42 OS=Homo sapiens GN=DDX42 PE=1 SV=1 30 438 5.0E-38
sp|Q89AF9|DEAD_BUCBP ATP-dependent RNA helicase DeaD OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=deaD PE=3 SV=1 26 438 5.0E-38
sp|Q54QS3|DDX3_DICDI Probable ATP-dependent RNA helicase ddx3 OS=Dictyostelium discoideum GN=ddx3 PE=3 SV=1 30 434 6.0E-38
sp|A2QWW0|MAK5_ASPNC ATP-dependent RNA helicase mak5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mak5 PE=3 SV=1 30 439 6.0E-38
sp|Q63413|DX39B_RAT Spliceosome RNA helicase Ddx39b OS=Rattus norvegicus GN=Ddx39b PE=2 SV=3 7 458 7.0E-38
sp|Q9Z1N5|DX39B_MOUSE Spliceosome RNA helicase Ddx39b OS=Mus musculus GN=Ddx39b PE=1 SV=1 7 458 7.0E-38
sp|Q5JK84|RH15_ORYSJ DEAD-box ATP-dependent RNA helicase 15 OS=Oryza sativa subsp. japonica GN=Os01g0550000 PE=2 SV=1 32 434 8.0E-38
sp|Q5ZHZ0|DX39B_CHICK Spliceosome RNA helicase DDX39B OS=Gallus gallus GN=DDX39B PE=2 SV=1 7 458 9.0E-38
sp|Q0JM17|RH56_ORYSJ DEAD-box ATP-dependent RNA helicase 56 OS=Oryza sativa subsp. japonica GN=Os01g0549700 PE=2 SV=2 32 434 9.0E-38
sp|Q5R7D1|DDX42_PONAB ATP-dependent RNA helicase DDX42 OS=Pongo abelii GN=DDX42 PE=2 SV=1 30 438 1.0E-37
sp|Q6CEB8|DRS1_YARLI ATP-dependent RNA helicase DRS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DRS1 PE=3 SV=1 14 434 1.0E-37
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 31 439 1.0E-37
sp|Q2UQI6|DRS1_ASPOR ATP-dependent RNA helicase drs1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=drs1 PE=3 SV=2 14 338 1.0E-37
sp|Q5WR10|DX39B_CANLF Spliceosome RNA helicase DDX39B OS=Canis lupus familiaris GN=DDX39B PE=3 SV=1 7 458 2.0E-37
sp|Q5F485|DDX42_CHICK ATP-dependent RNA helicase DDX42 OS=Gallus gallus GN=DDX42 PE=2 SV=1 30 438 2.0E-37
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 30 439 2.0E-37
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 32 433 2.0E-37
sp|Q9M2E0|RH12_ARATH DEAD-box ATP-dependent RNA helicase 12 OS=Arabidopsis thaliana GN=RH12 PE=2 SV=1 10 481 2.0E-37
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 32 439 2.0E-37
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 31 433 3.0E-37
sp|Q5RE47|DX39B_PONAB Spliceosome RNA helicase DDX39B OS=Pongo abelii GN=DDX39B PE=2 SV=1 8 458 3.0E-37
sp|Q29024|DX39B_PIG Spliceosome RNA helicase DDX39B OS=Sus scrofa GN=DDX39B PE=3 SV=2 8 458 3.0E-37
sp|P60024|DX39B_PANTR Spliceosome RNA helicase DDX39B OS=Pan troglodytes GN=DDX39B PE=3 SV=1 8 458 3.0E-37
sp|Q5TM17|DX39B_MACMU Spliceosome RNA helicase DDX39B OS=Macaca mulatta GN=DDX39B PE=3 SV=1 8 458 3.0E-37
sp|Q13838|DX39B_HUMAN Spliceosome RNA helicase DDX39B OS=Homo sapiens GN=DDX39B PE=1 SV=1 8 458 3.0E-37
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 29 509 3.0E-37
sp|Q3T147|DX39B_BOVIN Spliceosome RNA helicase DDX39B OS=Bos taurus GN=DDX39B PE=2 SV=1 8 458 3.0E-37
sp|P21507|SRMB_ECOLI ATP-dependent RNA helicase SrmB OS=Escherichia coli (strain K12) GN=srmB PE=1 SV=1 30 434 3.0E-37
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 3 433 3.0E-37
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 20 433 6.0E-37
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 29 443 6.0E-37
sp|A5DPU0|MAK5_PICGU ATP-dependent RNA helicase MAK5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MAK5 PE=3 SV=1 29 438 6.0E-37
sp|A3GHW9|ROK1_PICST ATP-dependent RNA helicase ROK1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ROK1 PE=3 SV=1 37 433 6.0E-37
sp|A7TK63|DBP8_VANPO ATP-dependent RNA helicase DBP8 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP8 PE=3 SV=1 32 441 7.0E-37
sp|C4K8M8|RHLB_HAMD5 ATP-dependent RNA helicase RhlB OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rhlB PE=3 SV=1 32 450 7.0E-37
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 31 438 7.0E-37
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 29 438 7.0E-37
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 31 433 7.0E-37
sp|Q7ZY47|DDX42_XENLA ATP-dependent RNA helicase DDX42 OS=Xenopus laevis GN=ddx42 PE=2 SV=1 30 438 8.0E-37
sp|A4REU9|MAK5_MAGO7 ATP-dependent RNA helicase MAK5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MAK5 PE=3 SV=2 22 439 8.0E-37
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 32 433 9.0E-37
sp|A1CKJ0|DBP8_ASPCL ATP-dependent RNA helicase dbp8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp8 PE=3 SV=1 27 434 9.0E-37
sp|O13792|SUB2_SCHPO ATP-dependent RNA helicase uap56 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uap56 PE=1 SV=3 30 461 1.0E-36
sp|A2YV85|RH29_ORYSI DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. indica GN=OsI_028228 PE=2 SV=2 7 439 1.0E-36
sp|Q54E49|DDX6_DICDI Probable ATP-dependent RNA helicase ddx6 OS=Dictyostelium discoideum GN=ddx6 PE=3 SV=1 28 434 1.0E-36
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 31 433 1.0E-36
sp|Q59LU0|DBP2_CANAL ATP-dependent RNA helicase DBP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP2 PE=3 SV=2 30 433 2.0E-36
sp|Q94C75|RH25_ARATH DEAD-box ATP-dependent RNA helicase 25 OS=Arabidopsis thaliana GN=RH25 PE=2 SV=2 18 450 2.0E-36
sp|A3BT52|RH29_ORYSJ DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. japonica GN=Os08g0416100 PE=2 SV=2 7 439 2.0E-36
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 30 433 2.0E-36
sp|Q6CDS6|ROK1_YARLI ATP-dependent RNA helicase ROK1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ROK1 PE=3 SV=1 31 433 2.0E-36
sp|A4RGU2|DBP4_MAGO7 ATP-dependent RNA helicase DBP4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP4 PE=3 SV=1 32 456 2.0E-36
sp|Q4P5U4|DBP4_USTMA ATP-dependent RNA helicase DBP4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP4 PE=3 SV=2 32 438 3.0E-36
sp|Q84TG1|RH57_ARATH DEAD-box ATP-dependent RNA helicase 57 OS=Arabidopsis thaliana GN=RH57 PE=2 SV=1 31 488 3.0E-36
sp|A5DDN0|SUB2_PICGU ATP-dependent RNA helicase SUB2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SUB2 PE=3 SV=3 9 438 3.0E-36
sp|A3LP87|DBP8_PICST ATP-dependent RNA helicase DBP8 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP8 PE=3 SV=2 31 441 3.0E-36
sp|B4F1V3|RHLB_PROMH ATP-dependent RNA helicase RhlB OS=Proteus mirabilis (strain HI4320) GN=rhlB PE=3 SV=1 32 445 4.0E-36
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 31 433 4.0E-36
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1 33 431 5.0E-36
sp|Q5N7W4|RH30_ORYSJ DEAD-box ATP-dependent RNA helicase 30 OS=Oryza sativa subsp. japonica GN=Os01g0911100 PE=2 SV=2 42 435 5.0E-36
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 31 433 5.0E-36
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 30 434 5.0E-36
sp|Q27268|DX39B_DROME ATP-dependent RNA helicase WM6 OS=Drosophila melanogaster GN=Hel25E PE=1 SV=1 32 461 8.0E-36
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 31 433 8.0E-36
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 31 434 8.0E-36
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 31 433 8.0E-36
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=Oryza sativa subsp. japonica GN=Os01g0549400 PE=2 SV=2 30 433 9.0E-36
sp|Q94BV4|RH6_ARATH DEAD-box ATP-dependent RNA helicase 6 OS=Arabidopsis thaliana GN=RH6 PE=2 SV=2 32 443 9.0E-36
sp|Q6CXW0|DBP8_KLULA ATP-dependent RNA helicase DBP8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP8 PE=3 SV=1 32 441 9.0E-36
sp|Q6C799|DBP8_YARLI ATP-dependent RNA helicase DBP8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP8 PE=3 SV=1 31 441 1.0E-35
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 31 433 1.0E-35
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 31 433 1.0E-35
sp|Q4WXW1|DBP8_ASPFU ATP-dependent RNA helicase dbp8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp8 PE=3 SV=1 27 434 1.0E-35
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 31 439 1.0E-35
sp|Q5QYF8|RHLB_IDILO ATP-dependent RNA helicase RhlB OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rhlB PE=3 SV=1 30 440 1.0E-35
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 30 434 1.0E-35
sp|Q5ZBH5|RH25_ORYSJ DEAD-box ATP-dependent RNA helicase 25 OS=Oryza sativa subsp. japonica GN=Os01g0618400 PE=2 SV=1 30 440 2.0E-35
sp|P21693|DBPA_ECOLI ATP-dependent RNA helicase DbpA OS=Escherichia coli (strain K12) GN=dbpA PE=1 SV=2 30 444 2.0E-35
sp|A1D6X9|DBP8_NEOFI ATP-dependent RNA helicase dbp8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp8 PE=3 SV=1 27 434 2.0E-35
sp|Q088J2|RHLB_SHEFN ATP-dependent RNA helicase RhlB OS=Shewanella frigidimarina (strain NCIMB 400) GN=rhlB PE=3 SV=1 32 445 2.0E-35
sp|Q6BY27|DBP2_DEBHA ATP-dependent RNA helicase DBP2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP2 PE=3 SV=1 30 433 2.0E-35
sp|A7TEG8|MAK5_VANPO ATP-dependent RNA helicase MAK5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MAK5 PE=3 SV=1 42 438 2.0E-35
sp|Q8RXK6|RH8_ARATH DEAD-box ATP-dependent RNA helicase 8 OS=Arabidopsis thaliana GN=RH8 PE=2 SV=1 13 441 2.0E-35
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 32 439 3.0E-35
sp|Q6CGD1|DBP4_YARLI ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP4 PE=3 SV=1 24 456 3.0E-35
sp|P19109|DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3 32 433 3.0E-35
sp|C4LB49|RHLB_TOLAT ATP-dependent RNA helicase RhlB OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rhlB PE=3 SV=1 31 445 3.0E-35
sp|Q4WMS3|MAK5_ASPFU ATP-dependent RNA helicase mak5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mak5 PE=3 SV=2 20 439 3.0E-35
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 30 437 3.0E-35
sp|Q1EB31|DBP4_COCIM ATP-dependent RNA helicase DBP4 OS=Coccidioides immitis (strain RS) GN=DBP4 PE=3 SV=1 31 438 3.0E-35
sp|Q54Y81|DDX23_DICDI ATP-dependent RNA helicase ddx23 OS=Dictyostelium discoideum GN=helB2 PE=2 SV=1 31 439 3.0E-35
sp|A5DLE0|DBP8_PICGU ATP-dependent RNA helicase DBP8 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP8 PE=3 SV=2 31 441 3.0E-35
sp|A3GG51|MAK5_PICST ATP-dependent RNA helicase MAK5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MAK5 PE=3 SV=2 33 438 4.0E-35
sp|A1DMT9|MAK5_NEOFI ATP-dependent RNA helicase mak5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mak5 PE=3 SV=1 20 439 4.0E-35
sp|A6VKC3|RHLB_ACTSZ ATP-dependent RNA helicase RhlB OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rhlB PE=3 SV=1 32 445 4.0E-35
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana GN=RH14 PE=1 SV=2 31 433 5.0E-35
sp|Q5AF95|DBP4_CANAL ATP-dependent RNA helicase DBP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP4 PE=3 SV=1 30 481 5.0E-35
sp|Q0I1X0|RHLB_HAES1 ATP-dependent RNA helicase RhlB OS=Haemophilus somnus (strain 129Pt) GN=rhlB PE=3 SV=1 32 445 5.0E-35
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 31 439 5.0E-35
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 31 433 5.0E-35
sp|Q7XMK8|RH6_ORYSJ DEAD-box ATP-dependent RNA helicase 6 OS=Oryza sativa subsp. japonica GN=Os04g0533000 PE=2 SV=1 7 441 6.0E-35
sp|A3LST5|SUB2_PICST ATP-dependent RNA helicase SUB2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SUB2 PE=3 SV=1 30 438 6.0E-35
sp|A7TGU7|DHH1_VANPO ATP-dependent RNA helicase DHH1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DHH1 PE=3 SV=1 15 434 6.0E-35
sp|Q9SQV1|RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana GN=RH40 PE=2 SV=1 31 433 7.0E-35
sp|C6DHF5|RHLB_PECCP ATP-dependent RNA helicase RhlB OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rhlB PE=3 SV=1 32 445 7.0E-35
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2 SV=1 31 438 7.0E-35
sp|A5DIP0|DHH1_PICGU ATP-dependent RNA helicase DHH1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DHH1 PE=3 SV=1 31 434 7.0E-35
sp|Q09181|DHH1_SCHPO Putative ATP-dependent RNA helicase ste13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste13 PE=3 SV=1 30 434 8.0E-35
sp|Q6FQU5|DHH1_CANGA ATP-dependent RNA helicase DHH1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DHH1 PE=3 SV=1 31 434 8.0E-35
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 31 433 8.0E-35
sp|Q75C76|DBP4_ASHGO ATP-dependent RNA helicase DBP4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP4 PE=3 SV=2 30 481 1.0E-34
sp|A3LWX3|DHH1_PICST ATP-dependent RNA helicase DHH1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHH1 PE=3 SV=1 31 471 1.0E-34
sp|Q6FQZ0|DBP8_CANGA ATP-dependent RNA helicase DBP8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP8 PE=3 SV=1 24 441 1.0E-34
sp|Q18212|DX39B_CAEEL Spliceosome RNA helicase DDX39B homolog OS=Caenorhabditis elegans GN=hel-1 PE=2 SV=1 32 434 1.0E-34
sp|Q2H4D0|SUB2_CHAGB ATP-dependent RNA helicase SUB2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SUB2 PE=3 SV=1 30 434 2.0E-34
sp|A5DUB2|MAK5_LODEL ATP-dependent RNA helicase MAK5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MAK5 PE=3 SV=1 37 438 2.0E-34
sp|Q8VDW0|DX39A_MOUSE ATP-dependent RNA helicase DDX39A OS=Mus musculus GN=Ddx39a PE=1 SV=1 12 458 2.0E-34
sp|B0UUZ9|RHLB_HISS2 ATP-dependent RNA helicase RhlB OS=Histophilus somni (strain 2336) GN=rhlB PE=3 SV=1 32 445 2.0E-34
sp|Q755N4|DBP2_ASHGO ATP-dependent RNA helicase DBP2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP2 PE=3 SV=2 31 433 2.0E-34
sp|A9L5D5|RHLB_SHEB9 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS195) GN=rhlB PE=3 SV=1 32 445 3.0E-34
sp|A6WTD3|RHLB_SHEB8 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS185) GN=rhlB PE=3 SV=1 32 445 3.0E-34
sp|Q6CM95|SUB2_KLULA ATP-dependent RNA helicase SUB2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUB2 PE=3 SV=1 16 461 3.0E-34
sp|P39517|DHH1_YEAST ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHH1 PE=1 SV=1 31 434 3.0E-34
sp|A6ZXG9|DHH1_YEAS7 ATP-dependent RNA helicase DHH1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DHH1 PE=3 SV=1 31 434 3.0E-34
sp|P54824|DDX6_XENLA ATP-dependent RNA helicase ddx6 OS=Xenopus laevis GN=ddx6 PE=1 SV=2 32 434 3.0E-34
sp|Q5U216|DX39A_RAT ATP-dependent RNA helicase DDX39A OS=Rattus norvegicus GN=Ddx39a PE=2 SV=1 12 458 3.0E-34
sp|A3D9I5|RHLB_SHEB5 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rhlB PE=3 SV=1 32 445 3.0E-34
sp|B8E670|RHLB_SHEB2 ATP-dependent RNA helicase RhlB OS=Shewanella baltica (strain OS223) GN=rhlB PE=3 SV=1 32 445 3.0E-34
sp|Q9FFQ1|RH31_ARATH DEAD-box ATP-dependent RNA helicase 31 OS=Arabidopsis thaliana GN=RH31 PE=2 SV=2 29 449 3.0E-34
sp|P38719|DBP8_YEAST ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP8 PE=1 SV=1 32 441 3.0E-34
sp|A6ZT77|DBP8_YEAS7 ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP8 PE=3 SV=1 32 441 3.0E-34
sp|Q6CZD9|RHLB_PECAS ATP-dependent RNA helicase RhlB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rhlB PE=3 SV=3 32 445 3.0E-34
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 30 438 3.0E-34
sp|A5E3W5|SUB2_LODEL ATP-dependent RNA helicase SUB2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SUB2 PE=3 SV=1 30 438 3.0E-34
sp|Q5B3H7|DBP8_EMENI ATP-dependent RNA helicase dbp8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp8 PE=3 SV=1 28 434 3.0E-34
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 30 433 3.0E-34
sp|A3AVH5|RH13_ORYSJ DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. japonica GN=Os04g0510400 PE=2 SV=2 27 453 3.0E-34
sp|A2XVF7|RH13_ORYSI DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. indica GN=OsI_016050 PE=3 SV=2 27 453 3.0E-34
sp|Q1E5R1|DHH1_COCIM ATP-dependent RNA helicase DHH1 OS=Coccidioides immitis (strain RS) GN=DHH1 PE=3 SV=1 32 434 3.0E-34
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 41 439 4.0E-34
sp|Q1E0Z3|DBP8_COCIM ATP-dependent RNA helicase DBP8 OS=Coccidioides immitis (strain RS) GN=DBP8 PE=3 SV=1 30 434 4.0E-34
sp|Q0TXZ2|SUB2_PHANO ATP-dependent RNA helicase SUB2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SUB2 PE=3 SV=1 15 434 4.0E-34
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 30 433 4.0E-34
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 30 433 4.0E-34
sp|Q6CRF4|DBP4_KLULA ATP-dependent RNA helicase DBP4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP4 PE=3 SV=1 32 438 4.0E-34
sp|Q95YF3|CGH1_CAEEL ATP-dependent RNA helicase cgh-1 OS=Caenorhabditis elegans GN=cgh-1 PE=1 SV=1 21 434 4.0E-34
sp|Q109G2|RH12_ORYSJ DEAD-box ATP-dependent RNA helicase 12 OS=Oryza sativa subsp. japonica GN=Os10g0503700 PE=2 SV=2 4 441 4.0E-34
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 30 433 4.0E-34
sp|A3Q9R3|RHLB_SHELP ATP-dependent RNA helicase RhlB OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rhlB PE=3 SV=1 32 468 4.0E-34
sp|A7E449|DBP2_SCLS1 ATP-dependent RNA helicase dbp2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp2 PE=3 SV=1 31 433 5.0E-34
sp|A4RBS3|SUB2_MAGO7 ATP-dependent RNA helicase SUB2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SUB2 PE=3 SV=1 30 434 5.0E-34
sp|Q59ZH9|MAK5_CANAL ATP-dependent RNA helicase MAK5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MAK5 PE=3 SV=1 33 438 5.0E-34
sp|Q75BS4|DHH1_ASHGO ATP-dependent RNA helicase DHH1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DHH1 PE=3 SV=1 31 434 5.0E-34
sp|A1SZG4|RHLB_PSYIN ATP-dependent RNA helicase RhlB OS=Psychromonas ingrahamii (strain 37) GN=rhlB PE=3 SV=1 29 440 6.0E-34
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 26 434 6.0E-34
sp|Q0CI35|MAK5_ASPTN ATP-dependent RNA helicase mak5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mak5 PE=3 SV=2 6 439 6.0E-34
sp|Q6LLL5|RHLB_PHOPR ATP-dependent RNA helicase RhlB OS=Photobacterium profundum GN=rhlB PE=3 SV=1 21 453 6.0E-34
sp|Q6H7S2|RH8_ORYSJ DEAD-box ATP-dependent RNA helicase 8 OS=Oryza sativa subsp. japonica GN=Os02g0641800 PE=2 SV=2 32 441 6.0E-34
sp|Q9WTM2|DDX6_CAVPO Probable ATP-dependent RNA helicase DDX6 (Fragment) OS=Cavia porcellus GN=DDX6 PE=2 SV=1 32 434 7.0E-34
sp|P27639|IF4A_CAEEL Eukaryotic initiation factor 4A OS=Caenorhabditis elegans GN=inf-1 PE=2 SV=1 31 434 7.0E-34
sp|Q5BCI0|MAK5_EMENI ATP-dependent RNA helicase mak5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mak5 PE=3 SV=1 30 439 7.0E-34
sp|A1RFB3|RHLB_SHESW ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain W3-18-1) GN=rhlB PE=3 SV=1 32 445 7.0E-34
sp|A4YB09|RHLB_SHEPC ATP-dependent RNA helicase RhlB OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rhlB PE=3 SV=1 32 445 7.0E-34
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 20 439 7.0E-34
sp|Q59PR3|DBP8_CANAL ATP-dependent RNA helicase DBP8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP8 PE=3 SV=1 31 441 8.0E-34
sp|A6SFW7|DBP2_BOTFB ATP-dependent RNA helicase dbp2 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp2 PE=3 SV=2 31 433 8.0E-34
sp|A5AA68|DBP8_ASPNC ATP-dependent RNA helicase dbp8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp8 PE=3 SV=1 29 434 8.0E-34
sp|P26196|DDX6_HUMAN Probable ATP-dependent RNA helicase DDX6 OS=Homo sapiens GN=DDX6 PE=1 SV=2 32 434 8.0E-34
sp|Q6CIV2|DBP2_KLULA ATP-dependent RNA helicase DBP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP2 PE=3 SV=1 31 433 8.0E-34
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 26 434 9.0E-34
sp|P54823|DDX6_MOUSE Probable ATP-dependent RNA helicase DDX6 OS=Mus musculus GN=Ddx6 PE=1 SV=1 32 434 9.0E-34
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 31 439 1.0E-33
sp|Q5BCU6|PRP28_EMENI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp28 PE=3 SV=2 31 434 1.0E-33
sp|O00148|DX39A_HUMAN ATP-dependent RNA helicase DDX39A OS=Homo sapiens GN=DDX39A PE=1 SV=2 12 458 1.0E-33
sp|Q5K5B6|RH57_ORYSJ DEAD-box ATP-dependent RNA helicase 57 OS=Oryza sativa subsp. japonica GN=Os07g0647900 PE=2 SV=2 36 433 1.0E-33
sp|Q6BJX6|DHH1_DEBHA ATP-dependent RNA helicase DHH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DHH1 PE=3 SV=2 31 471 1.0E-33
sp|B6EPA4|RHLB_ALISL ATP-dependent RNA helicase RhlB OS=Aliivibrio salmonicida (strain LFI1238) GN=rhlB PE=3 SV=1 21 453 1.0E-33
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 41 439 1.0E-33
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 26 434 1.0E-33
sp|Q0DBU5|RH31_ORYSJ DEAD-box ATP-dependent RNA helicase 31 OS=Oryza sativa subsp. japonica GN=Os06g0526600 PE=3 SV=2 5 450 1.0E-33
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 41 435 1.0E-33
sp|A3GGE9|DBP4_PICST ATP-dependent RNA helicase DBP4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP4 PE=3 SV=2 30 481 1.0E-33
sp|A7TLA0|SUB21_VANPO ATP-dependent RNA helicase SUB2-1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SUB2-1 PE=3 SV=1 30 461 2.0E-33
sp|Q0HQL1|RHLB_SHESR ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-7) GN=rhlB PE=3 SV=1 32 445 2.0E-33
sp|Q0HN76|RHLB_SHESM ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain MR-4) GN=rhlB PE=3 SV=1 32 445 2.0E-33
sp|Q8EJQ5|RHLB_SHEON ATP-dependent RNA helicase RhlB OS=Shewanella oneidensis (strain MR-1) GN=rhlB PE=3 SV=1 32 445 2.0E-33
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 31 435 2.0E-33
sp|A7ESL8|DBP4_SCLS1 ATP-dependent RNA helicase dbp4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp4 PE=3 SV=1 28 438 2.0E-33
sp|C3LQR1|RHLB_VIBCM ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rhlB PE=3 SV=1 21 453 2.0E-33
sp|Q9KV52|RHLB_VIBCH ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rhlB PE=3 SV=1 21 453 2.0E-33
sp|A5F3R4|RHLB_VIBC3 ATP-dependent RNA helicase RhlB OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rhlB PE=3 SV=1 21 453 2.0E-33
sp|Q0IHV9|DDX6_XENTR Probable ATP-dependent RNA helicase ddx6 OS=Xenopus tropicalis GN=ddx6 PE=2 SV=1 32 434 2.0E-33
sp|Q5ZKB9|DDX6_CHICK Probable ATP-dependent RNA helicase DDX6 OS=Gallus gallus GN=DDX6 PE=2 SV=1 32 434 2.0E-33
sp|Q6C024|PRP28_YARLI Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP28 PE=3 SV=1 45 434 2.0E-33
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 20 439 2.0E-33
sp|Q6K7R9|RH48_ORYSJ DEAD-box ATP-dependent RNA helicase 48 OS=Oryza sativa subsp. japonica GN=Os02g0826100 PE=2 SV=1 32 440 2.0E-33
sp|Q9UTP9|DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp4 PE=1 SV=1 32 438 3.0E-33
sp|A4R715|DHH1_MAGO7 ATP-dependent RNA helicase DHH1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DHH1 PE=3 SV=2 24 434 3.0E-33
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 31 433 3.0E-33
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 31 439 3.0E-33
sp|Q54Q94|DDX10_DICDI Probable ATP-dependent RNA helicase ddx10 OS=Dictyostelium discoideum GN=ddx10 PE=3 SV=1 30 438 3.0E-33
sp|Q2UKX3|DBP8_ASPOR ATP-dependent RNA helicase dbp8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp8 PE=3 SV=1 29 434 3.0E-33
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 20 439 3.0E-33
sp|Q7RZ35|DBP4_NEUCR ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-4 PE=3 SV=1 26 438 4.0E-33
sp|A1CHL3|PRP28_ASPCL Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp28 PE=3 SV=1 31 434 4.0E-33
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 31 439 4.0E-33
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRP3 PE=3 SV=1 31 439 4.0E-33
sp|Q5E8U5|RHLB_VIBF1 ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rhlB PE=3 SV=2 31 445 4.0E-33
sp|Q759L6|SUB2_ASHGO ATP-dependent RNA helicase SUB2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SUB2 PE=3 SV=1 30 461 4.0E-33
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 31 439 4.0E-33
sp|B5FF87|RHLB_VIBFM ATP-dependent RNA helicase RhlB OS=Vibrio fischeri (strain MJ11) GN=rhlB PE=3 SV=1 31 445 5.0E-33
sp|A1D8G1|DHH1_NEOFI ATP-dependent RNA helicase dhh1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dhh1 PE=3 SV=1 32 434 5.0E-33
sp|Q8SRB2|DBP2_ENCCU ATP-dependent RNA helicase DBP2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP2 PE=3 SV=1 32 433 5.0E-33
sp|A6R603|SUB2_AJECN ATP-dependent RNA helicase SUB2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SUB2 PE=3 SV=2 30 464 5.0E-33
sp|Q2U5A2|DHH1_ASPOR ATP-dependent RNA helicase dhh1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dhh1 PE=3 SV=1 32 434 5.0E-33
sp|Q2UHC1|DBP10_ASPOR ATP-dependent RNA helicase dbp10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp10 PE=3 SV=1 14 222 5.0E-33
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 31 439 5.0E-33
sp|Q4WWD3|DHH1_ASPFU ATP-dependent RNA helicase dhh1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dhh1 PE=3 SV=1 32 434 5.0E-33
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 31 439 6.0E-33
sp|Q4HW67|DHH1_GIBZE ATP-dependent RNA helicase DHH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DHH1 PE=3 SV=1 24 434 6.0E-33
sp|A1CJ18|DHH1_ASPCL ATP-dependent RNA helicase dhh1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dhh1 PE=3 SV=1 32 434 6.0E-33
sp|Q6BME5|SUB2_DEBHA ATP-dependent RNA helicase SUB2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUB2 PE=3 SV=2 30 438 6.0E-33
sp|A4R8G3|DBP8_MAGO7 ATP-dependent RNA helicase DBP8 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP8 PE=3 SV=3 8 434 7.0E-33
sp|Q6CH90|SUB2_YARLI ATP-dependent RNA helicase SUB2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SUB2 PE=3 SV=2 30 475 7.0E-33
sp|P23128|DDX6_DROME Putative ATP-dependent RNA helicase me31b OS=Drosophila melanogaster GN=me31B PE=1 SV=3 15 443 7.0E-33
sp|Q9SZB4|RH43_ARATH Putative DEAD-box ATP-dependent RNA helicase 43 OS=Arabidopsis thaliana GN=RH43 PE=3 SV=1 31 434 7.0E-33
sp|Q2UMY7|MAK5_ASPOR ATP-dependent RNA helicase mak5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mak5 PE=3 SV=1 30 439 8.0E-33
sp|Q6FN65|ROK1_CANGA ATP-dependent RNA helicase ROK1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ROK1 PE=3 SV=1 31 529 8.0E-33
sp|A1CTZ2|DBP4_ASPCL ATP-dependent RNA helicase dbp4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp4 PE=3 SV=1 31 438 8.0E-33
sp|A7TJT7|SUB22_VANPO ATP-dependent RNA helicase SUB2-2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SUB2-2 PE=3 SV=1 30 461 9.0E-33
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 24 434 9.0E-33
sp|P38112|MAK5_YEAST ATP-dependent RNA helicase MAK5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK5 PE=1 SV=1 28 438 9.0E-33
sp|Q0CBE1|DHH1_ASPTN ATP-dependent RNA helicase dhh1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dhh1 PE=3 SV=1 32 434 1.0E-32
sp|A2QIL2|PRP28_ASPNC Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp28 PE=3 SV=1 31 434 1.0E-32
sp|Q9HXE5|RHLB_PSEAE ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlB PE=3 SV=1 23 433 1.0E-32
sp|Q02S21|RHLB_PSEAB ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rhlB PE=3 SV=1 23 433 1.0E-32
sp|B7UUT0|RHLB_PSEA8 ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain LESB58) GN=rhlB PE=3 SV=1 23 433 1.0E-32
sp|Q7RZH4|MAK5_NEUCR ATP-dependent RNA helicase mak-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mak-5 PE=3 SV=1 28 438 1.0E-32
sp|B5BIS9|RHLB_SALPK ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi A (strain AKU_12601) GN=rhlB PE=3 SV=1 32 445 1.0E-32
sp|Q0U6X2|MAK5_PHANO ATP-dependent RNA helicase MAK5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MAK5 PE=3 SV=1 30 439 1.0E-32
sp|Q0U7S9|DHH1_PHANO ATP-dependent RNA helicase DHH1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DHH1 PE=3 SV=1 14 434 1.0E-32
sp|A2QY39|DHH1_ASPNC ATP-dependent RNA helicase dhh1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dhh1 PE=3 SV=1 32 434 1.0E-32
sp|A5DLR3|DBP10_PICGU ATP-dependent RNA helicase DBP10 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP10 PE=3 SV=2 31 222 1.0E-32
sp|A6RY31|DHH1_BOTFB ATP-dependent RNA helicase dhh1 OS=Botryotinia fuckeliana (strain B05.10) GN=dhh1 PE=3 SV=1 24 434 1.0E-32
sp|Q09775|ROK1_SCHPO ATP-dependent RNA helicase rok1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rok1 PE=3 SV=1 41 433 1.0E-32
sp|Q88NB7|RHLB_PSEPK ATP-dependent RNA helicase RhlB OS=Pseudomonas putida (strain KT2440) GN=rhlB PE=3 SV=1 23 433 1.0E-32
sp|Q6C9P3|DBP3_YARLI ATP-dependent RNA helicase DBP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP3 PE=3 SV=1 22 444 1.0E-32
sp|Q1DI07|SUB2_COCIM ATP-dependent RNA helicase SUB2 OS=Coccidioides immitis (strain RS) GN=SUB2 PE=3 SV=1 30 434 1.0E-32
sp|Q2GQ93|DHH1_CHAGB ATP-dependent RNA helicase DHH1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DHH1 PE=3 SV=1 32 434 2.0E-32
sp|Q4WPE9|PRP28_ASPFU Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp28 PE=3 SV=1 31 434 2.0E-32
sp|Q7S5D9|DHH1_NEUCR ATP-dependent RNA helicase dhh1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-10 PE=3 SV=3 24 434 2.0E-32
sp|A0KS84|RHLB_SHESA ATP-dependent RNA helicase RhlB OS=Shewanella sp. (strain ANA-3) GN=rhlB PE=3 SV=1 32 445 2.0E-32
sp|P0A2P0|RHLB_SALTY ATP-dependent RNA helicase RhlB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rhlB PE=3 SV=2 32 445 2.0E-32
sp|P0A2P1|RHLB_SALTI ATP-dependent RNA helicase RhlB OS=Salmonella typhi GN=rhlB PE=3 SV=2 32 445 2.0E-32
sp|B4TNT3|RHLB_SALSV ATP-dependent RNA helicase RhlB OS=Salmonella schwarzengrund (strain CVM19633) GN=rhlB PE=3 SV=1 32 445 2.0E-32
sp|C0Q2V9|RHLB_SALPC ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi C (strain RKS4594) GN=rhlB PE=3 SV=1 32 445 2.0E-32
sp|A9MXF3|RHLB_SALPB ATP-dependent RNA helicase RhlB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rhlB PE=3 SV=1 32 445 2.0E-32
sp|B4SZ26|RHLB_SALNS ATP-dependent RNA helicase RhlB OS=Salmonella newport (strain SL254) GN=rhlB PE=3 SV=1 32 445 2.0E-32
sp|B4TB13|RHLB_SALHS ATP-dependent RNA helicase RhlB OS=Salmonella heidelberg (strain SL476) GN=rhlB PE=3 SV=1 32 445 2.0E-32
sp|B5RFS3|RHLB_SALG2 ATP-dependent RNA helicase RhlB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rhlB PE=3 SV=1 32 445 2.0E-32
sp|B5QVH2|RHLB_SALEP ATP-dependent RNA helicase RhlB OS=Salmonella enteritidis PT4 (strain P125109) GN=rhlB PE=3 SV=1 32 445 2.0E-32
sp|Q57HT6|RHLB_SALCH ATP-dependent RNA helicase RhlB OS=Salmonella choleraesuis (strain SC-B67) GN=rhlB PE=3 SV=1 32 445 2.0E-32
sp|B5EZ40|RHLB_SALA4 ATP-dependent RNA helicase RhlB OS=Salmonella agona (strain SL483) GN=rhlB PE=3 SV=1 32 445 2.0E-32
sp|Q0CLX0|PRP28_ASPTN Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp28 PE=3 SV=1 31 434 2.0E-32
sp|Q0UWC8|PRP28_PHANO Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PRP28 PE=3 SV=1 31 433 2.0E-32
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 34 439 2.0E-32
sp|A9MJ29|RHLB_SALAR ATP-dependent RNA helicase RhlB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rhlB PE=3 SV=1 32 445 2.0E-32
sp|Q0UMB9|DBP4_PHANO ATP-dependent RNA helicase DBP4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP4 PE=3 SV=1 32 438 3.0E-32
sp|P0CQ91|MAK5_CRYNB ATP-dependent RNA helicase MAK5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MAK5 PE=3 SV=1 32 438 3.0E-32
sp|Q757I6|MAK5_ASHGO ATP-dependent RNA helicase MAK5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MAK5 PE=3 SV=1 19 438 3.0E-32
sp|A1CMQ7|SUB2_ASPCL ATP-dependent RNA helicase sub2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sub2 PE=3 SV=1 30 464 3.0E-32
sp|A5UDI1|RHLB_HAEIE ATP-dependent RNA helicase RhlB OS=Haemophilus influenzae (strain PittEE) GN=rhlB PE=3 SV=1 32 445 3.0E-32
sp|A2R0B5|SUB2_ASPNC ATP-dependent RNA helicase sub2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sub2 PE=3 SV=1 30 464 3.0E-32
sp|Q09719|DBP10_SCHPO ATP-dependent RNA helicase dbp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp10 PE=1 SV=1 30 278 4.0E-32
sp|A6ZL85|MAK5_YEAS7 ATP-dependent RNA helicase MAK5 OS=Saccharomyces cerevisiae (strain YJM789) GN=MAK5 PE=3 SV=1 28 438 4.0E-32
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 31 439 4.0E-32
sp|Q2UH00|PRP28_ASPOR Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp28 PE=3 SV=1 31 434 4.0E-32
sp|A5E3K3|DBP4_LODEL ATP-dependent RNA helicase DBP4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP4 PE=3 SV=1 32 438 4.0E-32
sp|P0CQ90|MAK5_CRYNJ ATP-dependent RNA helicase MAK5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MAK5 PE=3 SV=1 32 438 4.0E-32
sp|A1CX72|PRP28_NEOFI Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp28 PE=3 SV=1 31 434 4.0E-32
sp|A0KEG9|RHLB_AERHH ATP-dependent RNA helicase RhlB OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rhlB PE=3 SV=1 32 445 4.0E-32
sp|A1DL85|SUB2_NEOFI ATP-dependent RNA helicase sub2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sub2 PE=3 SV=1 30 464 4.0E-32
sp|Q5AAW3|DHH1_CANAL ATP-dependent RNA helicase DHH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DHH1 PE=3 SV=1 31 474 4.0E-32
sp|Q0JL73|RH26_ORYSJ DEAD-box ATP-dependent RNA helicase 26 OS=Oryza sativa subsp. japonica GN=Os01g0618500 PE=2 SV=1 30 440 5.0E-32
sp|Q07478|SUB2_YEAST ATP-dependent RNA helicase SUB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUB2 PE=1 SV=1 17 461 5.0E-32
sp|A6ZXP4|SUB2_YEAS7 ATP-dependent RNA helicase SUB2 OS=Saccharomyces cerevisiae (strain YJM789) GN=SUB2 PE=3 SV=1 17 461 5.0E-32
sp|Q6CSZ7|DHH1_KLULA ATP-dependent RNA helicase DHH1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DHH1 PE=3 SV=1 31 434 5.0E-32
sp|A5DE68|FAL1_PICGU ATP-dependent RNA helicase FAL1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=FAL1 PE=3 SV=2 31 438 5.0E-32
sp|A5DID7|HAS1_PICGU ATP-dependent RNA helicase HAS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HAS1 PE=3 SV=2 15 488 5.0E-32
sp|P45818|ROK1_YEAST ATP-dependent RNA helicase ROK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROK1 PE=1 SV=1 31 433 5.0E-32
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=Arabidopsis thaliana GN=RH46 PE=2 SV=2 31 433 6.0E-32
sp|A6ZU15|ROK1_YEAS7 ATP-dependent RNA helicase ROK1 OS=Saccharomyces cerevisiae (strain YJM789) GN=ROK1 PE=3 SV=1 31 433 7.0E-32
sp|Q13206|DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens GN=DDX10 PE=1 SV=2 28 438 7.0E-32
sp|A8ACT3|RHLB_CITK8 ATP-dependent RNA helicase RhlB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rhlB PE=3 SV=1 32 449 7.0E-32
sp|Q6BXG0|DBP4_DEBHA ATP-dependent RNA helicase DBP4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP4 PE=3 SV=2 30 438 9.0E-32
sp|A5E1W4|DBP3_LODEL ATP-dependent RNA helicase DBP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP3 PE=3 SV=2 50 444 9.0E-32
sp|Q5RFQ5|DDX6_PONAB Probable ATP-dependent RNA helicase DDX6 OS=Pongo abelii GN=DDX6 PE=2 SV=1 32 434 1.0E-31
sp|A5DWJ1|FAL1_LODEL ATP-dependent RNA helicase FAL1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=FAL1 PE=3 SV=1 31 434 1.0E-31
sp|Q5ZJF6|DDX10_CHICK Probable ATP-dependent RNA helicase DDX10 OS=Gallus gallus GN=DDX10 PE=2 SV=1 32 438 1.0E-31
sp|A7MQI2|RHLB_CROS8 ATP-dependent RNA helicase RhlB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rhlB PE=3 SV=1 32 445 1.0E-31
sp|Q2UHB7|DBP4_ASPOR ATP-dependent RNA helicase dbp4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp4 PE=3 SV=1 27 438 1.0E-31
sp|Q8K301|DDX52_MOUSE Probable ATP-dependent RNA helicase DDX52 OS=Mus musculus GN=Ddx52 PE=2 SV=2 2 433 1.0E-31
sp|A5UI36|RHLB_HAEIG ATP-dependent RNA helicase RhlB OS=Haemophilus influenzae (strain PittGG) GN=rhlB PE=3 SV=1 32 445 1.0E-31
sp|C8V8H4|DED1_EMENI ATP-dependent RNA helicase ded1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ded1 PE=3 SV=1 27 433 1.0E-31
sp|Q54S03|DDX18_DICDI Probable ATP-dependent RNA helicase ddx18 OS=Dictyostelium discoideum GN=ddx18 PE=3 SV=1 26 439 2.0E-31
sp|Q80Y44|DDX10_MOUSE Probable ATP-dependent RNA helicase DDX10 OS=Mus musculus GN=Ddx10 PE=1 SV=2 28 438 2.0E-31
sp|Q2U6P7|SUB2_ASPOR ATP-dependent RNA helicase sub2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sub2 PE=3 SV=1 30 464 2.0E-31
sp|B7NTG2|RHLB_ECO7I ATP-dependent RNA helicase RhlB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|A4R5B8|DBP10_MAGO7 ATP-dependent RNA helicase DBP10 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP10 PE=3 SV=1 32 222 2.0E-31
sp|Q86IZ9|DDX52_DICDI Probable ATP-dependent RNA helicase ddx52 OS=Dictyostelium discoideum GN=ddx52 PE=3 SV=1 2 433 2.0E-31
sp|B7LU75|RHLB_ESCF3 ATP-dependent RNA helicase RhlB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|B7NF85|RHLB_ECOLU ATP-dependent RNA helicase RhlB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|B5FN74|RHLB_SALDC ATP-dependent RNA helicase RhlB OS=Salmonella dublin (strain CT_02021853) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|Q329V8|RHLB_SHIDS ATP-dependent RNA helicase RhlB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|B5YY28|RHLB_ECO5E ATP-dependent RNA helicase RhlB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|Q3YVI4|RHLB_SHISS ATP-dependent RNA helicase RhlB OS=Shigella sonnei (strain Ss046) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|P0A8K0|RHLB_SHIFL ATP-dependent RNA helicase RhlB OS=Shigella flexneri GN=rhlB PE=3 SV=2 32 445 2.0E-31
sp|Q1R4F9|RHLB_ECOUT ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain UTI89 / UPEC) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|B6I4B6|RHLB_ECOSE ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain SE11) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|P0A8J8|RHLB_ECOLI ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12) GN=rhlB PE=1 SV=2 32 445 2.0E-31
sp|B1IWC0|RHLB_ECOLC ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|P0A8J9|RHLB_ECOL6 ATP-dependent RNA helicase RhlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rhlB PE=3 SV=2 32 445 2.0E-31
sp|Q0TAU3|RHLB_ECOL5 ATP-dependent RNA helicase RhlB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|A1AHV0|RHLB_ECOK1 ATP-dependent RNA helicase RhlB OS=Escherichia coli O1:K1 / APEC GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|A8A6N4|RHLB_ECOHS ATP-dependent RNA helicase RhlB OS=Escherichia coli O9:H4 (strain HS) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|B1X9Z4|RHLB_ECODH ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12 / DH10B) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|C4ZZ48|RHLB_ECOBW ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|B7M5C7|RHLB_ECO8A ATP-dependent RNA helicase RhlB OS=Escherichia coli O8 (strain IAI1) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|B7MR01|RHLB_ECO81 ATP-dependent RNA helicase RhlB OS=Escherichia coli O81 (strain ED1a) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|B7L8B6|RHLB_ECO55 ATP-dependent RNA helicase RhlB OS=Escherichia coli (strain 55989 / EAEC) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|B7MGJ1|RHLB_ECO45 ATP-dependent RNA helicase RhlB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|B7UMN5|RHLB_ECO27 ATP-dependent RNA helicase RhlB OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|A7ZTY2|RHLB_ECO24 ATP-dependent RNA helicase RhlB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|Q7MYL2|RHLB_PHOLL ATP-dependent RNA helicase RhlB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|A4STJ7|RHLB_AERS4 ATP-dependent RNA helicase RhlB OS=Aeromonas salmonicida (strain A449) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|A8G0U0|RHLB_SHESH ATP-dependent RNA helicase RhlB OS=Shewanella sediminis (strain HAW-EB3) GN=rhlB PE=3 SV=1 32 445 2.0E-31
sp|A6R9U4|MAK5_AJECN ATP-dependent RNA helicase MAK5 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MAK5 PE=3 SV=1 35 439 2.0E-31
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB10 OS=Nicotiana sylvestris PE=2 SV=1 30 469 3.0E-31
sp|Q5GUR8|RHLB_XANOR ATP-dependent RNA helicase RhlB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rhlB PE=3 SV=2 30 453 3.0E-31
sp|Q0SYX0|RHLB_SHIF8 ATP-dependent RNA helicase RhlB OS=Shigella flexneri serotype 5b (strain 8401) GN=rhlB PE=3 SV=1 32 445 3.0E-31
sp|Q6CIR0|DBP10_KLULA ATP-dependent RNA helicase DBP10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP10 PE=3 SV=1 31 266 3.0E-31
sp|P54475|CSHB_BACSU DEAD-box ATP-dependent RNA helicase CshB OS=Bacillus subtilis (strain 168) GN=cshB PE=1 SV=1 30 433 3.0E-31
sp|Q12S35|RHLB_SHEDO ATP-dependent RNA helicase RhlB OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rhlB PE=3 SV=1 32 445 3.0E-31
sp|Q87KH5|RHLB_VIBPA ATP-dependent RNA helicase RhlB OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rhlB PE=3 SV=1 21 445 3.0E-31
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0016787 hydrolase activity Yes
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10865
MKRKLDADGVPSPGPKAQGDKQAEETEERTTFADLGLDPRLLQAVAEQGFLTPTLVQRQAIPLAMNGQDVLCKAK
TGSGKTAAYVLPVLAGILKRKSTDASAAISALVLVPTRELADQVFREIERFSAYCAKDVQAVKLTDKLSDAVQRS
LLSTSPDIVISTPARAWHNVKSNNSALDASRLSHLVLDEADLLLSYGYEEDLENLSWSIPKGVQTIMMSATLTAE
IDSLKKIFYRSNAPALLDLEEPDGEGEGVTQLVTKCGEDEKFLLAYVIFKLQLVKGKCIIFVGDVDRCYRLKLFF
EQFGIRSCILNSELPVNSRLHVVEEFNRNVYDIIIASDEKEVLGNEEKAEEERGEEGGEARDEEAGSAGKDGRRP
PKKRKTSKRDKEYGVSRGIDFKNVAAVLNFDLPTSGSSYTHRIGRTARAGKAGMALSFVVPKELYRKHMPTTTAT
AENDEKVLARITRQQAKKGKEIKPYNFNIKQVEAFRYRMNDALRAVTKVAVREARTRELRQELLKSEKLKRYFEE
NPSEMKHLRHDGELRTARQQAHLKHIPDYLLPKEGRKALTEDEIGFVRMRGSGRTRGPRKGRGGRRGGGFRVGGR
KSDPLKSFKARRKTK*
Coding >Hirsu2|10865
ATGAAGCGCAAGCTAGACGCGGATGGCGTTCCGTCGCCGGGGCCCAAAGCACAAGGCGACAAACAGGCGGAGGAG
ACGGAGGAAAGGACGACATTTGCCGATCTGGGACTCGACCCGAGGCTGCTGCAGGCCGTGGCGGAGCAAGGCTTC
CTGACGCCGACGCTGGTGCAGCGACAGGCCATTCCCCTGGCAATGAACGGACAGGACGTGCTGTGCAAGGCAAAG
ACCGGGTCGGGAAAAACGGCGGCCTACGTCCTGCCCGTGCTGGCCGGAATCCTGAAGCGCAAGAGTACGGACGCC
AGCGCCGCCATCTCGGCCCTCGTACTGGTGCCCACCCGCGAACTGGCCGACCAGGTGTTCCGAGAGATCGAGCGA
TTCTCCGCCTACTGTGCCAAGGACGTCCAGGCGGTTAAGCTGACGGACAAGCTGTCGGATGCGGTGCAGAGATCC
TTGCTGTCGACCTCACCCGACATTGTCATCTCCACACCCGCCCGTGCCTGGCACAACGTCAAGTCGAACAACTCC
GCCCTGGACGCGAGCAGGCTCTCCCATCTCGTCCTGGACGAGGCCGACCTCCTCCTGTCGTATGGCTACGAGGAA
GATCTGGAGAATCTTTCGTGGTCGATTCCTAAGGGGGTACAGACGATCATGATGAGCGCCACGTTGACGGCCGAG
ATCGACTCGCTCAAGAAGATCTTTTACAGAAGCAACGCGCCGGCCCTGCTCGACCTGGAAGAGCCGGACGGCGAA
GGCGAGGGCGTGACGCAGTTGGTGACGAAGTGCGGCGAAGACGAGAAATTCCTCCTCGCATACGTCATCTTCAAG
CTCCAGCTGGTCAAGGGCAAATGCATCATCTTCGTCGGCGACGTGGACCGGTGCTACCGCCTCAAGCTCTTCTTT
GAGCAATTTGGCATCCGGAGCTGTATCCTCAACTCGGAACTGCCCGTCAACTCGCGACTACACGTGGTGGAAGAA
TTCAACCGCAACGTGTACGACATCATCATAGCCTCGGACGAGAAAGAGGTGCTCGGAAACGAGGAGAAGGCCGAG
GAGGAGAGGGGGGAGGAGGGGGGAGAGGCGCGCGACGAAGAGGCGGGAAGCGCCGGCAAAGACGGTCGACGGCCG
CCGAAGAAGCGGAAGACGTCGAAGCGGGACAAGGAGTATGGCGTGTCGCGAGGCATCGACTTCAAGAACGTGGCA
GCCGTGCTCAACTTTGACCTGCCGACGTCGGGCTCGTCGTACACACACAGGATCGGACGCACGGCGCGGGCCGGG
AAAGCGGGCATGGCGCTGTCGTTTGTCGTGCCGAAAGAGCTGTACCGCAAGCACATGCCGACGACGACGGCGACG
GCGGAGAACGACGAAAAGGTGCTGGCAAGAATCACGAGGCAGCAGGCCAAGAAGGGCAAGGAGATTAAGCCGTAC
AACTTCAACATCAAGCAGGTGGAGGCCTTCCGATACCGGATGAACGACGCGCTGCGAGCGGTGACCAAGGTGGCC
GTCCGCGAGGCAAGGACCAGAGAGCTGCGGCAGGAGCTGCTCAAGAGCGAGAAGCTCAAGAGATACTTTGAAGAG
AACCCATCGGAGATGAAGCACCTCCGACATGACGGCGAGCTGAGGACGGCCAGGCAGCAGGCGCACCTCAAGCAC
ATACCGGACTATCTGCTGCCCAAGGAGGGCAGAAAGGCGCTGACGGAAGACGAGATCGGCTTCGTCCGGATGCGG
GGCTCGGGCCGGACTCGGGGCCCGCGGAAGGGCCGGGGGGGCAGGCGAGGAGGCGGGTTCAGGGTGGGCGGAAGG
AAGAGCGATCCGCTCAAGTCGTTCAAGGCGCGGCGCAAGACGAAGTGA
Transcript >Hirsu2|10865
ATGAAGCGCAAGCTAGACGCGGATGGCGTTCCGTCGCCGGGGCCCAAAGCACAAGGCGACAAACAGGCGGAGGAG
ACGGAGGAAAGGACGACATTTGCCGATCTGGGACTCGACCCGAGGCTGCTGCAGGCCGTGGCGGAGCAAGGCTTC
CTGACGCCGACGCTGGTGCAGCGACAGGCCATTCCCCTGGCAATGAACGGACAGGACGTGCTGTGCAAGGCAAAG
ACCGGGTCGGGAAAAACGGCGGCCTACGTCCTGCCCGTGCTGGCCGGAATCCTGAAGCGCAAGAGTACGGACGCC
AGCGCCGCCATCTCGGCCCTCGTACTGGTGCCCACCCGCGAACTGGCCGACCAGGTGTTCCGAGAGATCGAGCGA
TTCTCCGCCTACTGTGCCAAGGACGTCCAGGCGGTTAAGCTGACGGACAAGCTGTCGGATGCGGTGCAGAGATCC
TTGCTGTCGACCTCACCCGACATTGTCATCTCCACACCCGCCCGTGCCTGGCACAACGTCAAGTCGAACAACTCC
GCCCTGGACGCGAGCAGGCTCTCCCATCTCGTCCTGGACGAGGCCGACCTCCTCCTGTCGTATGGCTACGAGGAA
GATCTGGAGAATCTTTCGTGGTCGATTCCTAAGGGGGTACAGACGATCATGATGAGCGCCACGTTGACGGCCGAG
ATCGACTCGCTCAAGAAGATCTTTTACAGAAGCAACGCGCCGGCCCTGCTCGACCTGGAAGAGCCGGACGGCGAA
GGCGAGGGCGTGACGCAGTTGGTGACGAAGTGCGGCGAAGACGAGAAATTCCTCCTCGCATACGTCATCTTCAAG
CTCCAGCTGGTCAAGGGCAAATGCATCATCTTCGTCGGCGACGTGGACCGGTGCTACCGCCTCAAGCTCTTCTTT
GAGCAATTTGGCATCCGGAGCTGTATCCTCAACTCGGAACTGCCCGTCAACTCGCGACTACACGTGGTGGAAGAA
TTCAACCGCAACGTGTACGACATCATCATAGCCTCGGACGAGAAAGAGGTGCTCGGAAACGAGGAGAAGGCCGAG
GAGGAGAGGGGGGAGGAGGGGGGAGAGGCGCGCGACGAAGAGGCGGGAAGCGCCGGCAAAGACGGTCGACGGCCG
CCGAAGAAGCGGAAGACGTCGAAGCGGGACAAGGAGTATGGCGTGTCGCGAGGCATCGACTTCAAGAACGTGGCA
GCCGTGCTCAACTTTGACCTGCCGACGTCGGGCTCGTCGTACACACACAGGATCGGACGCACGGCGCGGGCCGGG
AAAGCGGGCATGGCGCTGTCGTTTGTCGTGCCGAAAGAGCTGTACCGCAAGCACATGCCGACGACGACGGCGACG
GCGGAGAACGACGAAAAGGTGCTGGCAAGAATCACGAGGCAGCAGGCCAAGAAGGGCAAGGAGATTAAGCCGTAC
AACTTCAACATCAAGCAGGTGGAGGCCTTCCGATACCGGATGAACGACGCGCTGCGAGCGGTGACCAAGGTGGCC
GTCCGCGAGGCAAGGACCAGAGAGCTGCGGCAGGAGCTGCTCAAGAGCGAGAAGCTCAAGAGATACTTTGAAGAG
AACCCATCGGAGATGAAGCACCTCCGACATGACGGCGAGCTGAGGACGGCCAGGCAGCAGGCGCACCTCAAGCAC
ATACCGGACTATCTGCTGCCCAAGGAGGGCAGAAAGGCGCTGACGGAAGACGAGATCGGCTTCGTCCGGATGCGG
GGCTCGGGCCGGACTCGGGGCCCGCGGAAGGGCCGGGGGGGCAGGCGAGGAGGCGGGTTCAGGGTGGGCGGAAGG
AAGAGCGATCCGCTCAAGTCGTTCAAGGCGCGGCGCAAGACGAAGTGA
Gene >Hirsu2|10865
ATGAAGCGCAAGCTAGACGCGGATGGCGTTCCGTCGCCGGGGCCCAAAGCACAAGGCGACAAACAGGCGGAGGAG
ACGGAGGAAAGGACGACATTTGCCGATCTGGGACTCGACCCGAGGCTGCTGCAGGCCGTGGCGGAGCAAGGCTTC
CTGACGCCGACGCTGGTGCAGCGACAGGCCATTCCCCTGGCAATGAACGGACAGGACGTGCTGTGCAAGGCAAAG
ACCGGGTCGGGAAAAACGGCGGCCTACGTCCTGCCCGTGCTGGCCGGAATCCTGAAGCGCAAGAGTGTAGGTCTT
GGTCGCCGTCGGAGGCGGGCGCAACACGCACGGCTGCTAACACCGACACGGCAGACGGACGCCAGCGCCGCCATC
TCGGCCCTCGTACTGGTGCCCACCCGCGAACTGGCCGACCAGGTGTTCCGAGAGATCGAGCGATTCTCCGCCTAC
TGTGCCAAGGACGTCCAGGCGGTTAAGCTGACGGACAAGCTGTCGGATGCGGTGCAGAGATCCTTGCTGTCGACC
TCACCCGACATTGTCATCTCCACACCCGCCCGTGCCTGGCACAACGTCAAGTCGAACAACTCCGCCCTGGACGCG
AGCAGGCTCTCCCATCTCGTCCTGGACGAGGCCGACCTCCTCCTGTCGTATGGCTACGAGGAAGATCTGGAGAAT
CTTTCGTGGTCGATTCCTAAGGGGGTACAGACGATCATGATGAGCGCCACGTTGACGGCCGAGATCGACTCGCTC
AAGAAGATCTTTTACAGAAGCAACGCGCCGGCCCTGCTCGACCTGGAAGAGCCGGACGGCGAAGGCGAGGGCGTG
ACGCAGTTGGTGACGAAGTAGGTCTACGTGTGCGCCCCCCTCCGTGGCCCGACGCCTGCCTTGCTCACACGGCGC
CAGGTGCGGCGAAGACGAGAAATTCCTCCTCGCATACGTCATCTTCAAGCTCCAGCTGGTCAAGGGCAAATGCAT
CATCTTCGTCGGCGACGTGGACCGGTGCTACCGCCTCAAGCTCTTCTTTGAGCAATTTGGCATCCGGAGCTGTAT
CCTCAACTCGGAACTGCCCGTCAACTCGCGACTACACGTGGTGGAAGAATTCAACCGCAACGTGTACGACATCAT
CATAGCCTCGGACGAGAAAGAGGTGCTCGGAAACGAGGAGAAGGCCGAGGAGGAGAGGGGGGAGGAGGGGGGAGA
GGCGCGCGACGAAGAGGCGGGAAGCGCCGGCAAAGACGGTCGACGGCCGCCGAAGAAGCGGAAGACGTCGAAGCG
GGACAAGGAGTATGGCGTGTCGCGAGGTATGCAGCCGTGCACGACCGGCCGCAGAGGTGCTTGAGCTAACAGGAC
GGGACCCAGGCATCGACTTCAAGAACGTGGCAGCCGTGCTCAACTTTGACCTGCCGACGTCGGGCTCGTCGTACA
CACACAGGATCGGACGCACGGCGCGGGCCGGGAAAGCGGGCATGGCGCTGTCGTTTGTCGTGCCGAAAGAGCTGT
ACCGCAAGCACATGCCGACGACGACGGCGACGGCGGAGAACGACGAAAAGGTGCTGGCAAGAATCACGAGGCAGC
AGGCCAAGAAGGGCAAGGAGATTAAGCCGTACAACTTCAACATCAAGCAGGTGGAGGCCTTCCGATACCGGATGA
ACGACGCGCTGCGAGCGGTGACCAAGGTGGCCGTCCGCGAGGCAAGGACCAGAGAGCTGCGGCAGGAGCTGCTCA
AGAGCGAGAAGCTCAAGAGGTACGTATTTTCACGAGTGCCAGCCGACGATGCCGGCGGGGTATGTCTGGCACGAG
AGAGACGACGAGGTCTGACTGGCGACGGGGCGGGCAGATACTTTGAAGAGAACCCATCGGAGATGAAGCACCTCC
GACATGACGGCGAGCTGAGGACGGCCAGGCAGCAGGCGCACCTCAAGCACATACCGGACTATCTGCTGCCCAAGG
AGGGCAGAAAGGCGCTGACGGAAGACGAGATCGGCTTCGTCCGGATGCGGGGCTCGGGCCGGACTCGGGGCCCGC
GGAAGGGCCGGGGGGGCAGGCGAGGAGGCGGGTTCAGGGTGGGCGGAAGGAAGAGCGATCCGCTCAAGTCGTTCA
AGGCGCGGCGCAAGACGAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail