Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10862
Gene name
LocationContig_916:8321..9441
Strand+
Gene length (bp)1120
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01027 Bax1-I Inhibitor of apoptosis-promoting Bax1 1.1E-32 120 336

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q91VC9|GHITM_MOUSE Growth hormone-inducible transmembrane protein OS=Mus musculus GN=Ghitm PE=1 SV=1 116 344 1.0E-30
sp|Q9H3K2|GHITM_HUMAN Growth hormone-inducible transmembrane protein OS=Homo sapiens GN=GHITM PE=1 SV=2 116 344 5.0E-30
sp|Q5XIA8|GHITM_RAT Growth hormone-inducible transmembrane protein OS=Rattus norvegicus GN=Ghitm PE=2 SV=1 116 344 3.0E-29
sp|Q9VSH3|BI1_DROME Probable Bax inhibitor 1 OS=Drosophila melanogaster GN=CG7188 PE=2 SV=1 183 344 4.0E-08
sp|Q0V882|BI1_BOVIN Bax inhibitor 1 OS=Bos taurus GN=TMBIM6 PE=2 SV=1 209 340 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 87 106 19
2 126 145 19
3 158 180 22
4 200 220 20
5 241 263 22
6 278 295 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10862
MSFILSVRQGPVRLAHRLAATTVRAPAAAARGLHKAPSGGMAQRARTLKGAGASTTTRGAFLRLYHPEAAGQGQQ
GGFASGMGRRRLLVGGAIFGGTLLAINVVFNRETREDGGMPVYERDYLNNTFLHTGLGIGIIGLTARQMVQSGFV
YRLMVTNPWVVGLGGLALSFATMIGTRSISPDNYIPKYAMWTAFNATQAAFVAPLLAFVPVPLLARAGLYTVTMM
GALSVVGATAKQEKYLYIGGPLLAGAALVAASGLAPLVLPVTAVRTLALTEKVWLYGGLAVFGGFTLYDVQKVLH
HARLAEAGYMRRDPVNESIALELDFLNIFVRMVQILMMRQNQRK*
Coding >Hirsu2|10862
ATGTCGTTCATCCTCAGCGTGCGGCAGGGCCCGGTGCGGCTCGCGCATCGGCTCGCCGCGACGACGGTGCGGGCT
CCGGCGGCGGCGGCGCGCGGCCTCCACAAGGCCCCGAGCGGCGGCATGGCGCAGCGGGCGCGGACTCTGAAGGGC
GCGGGCGCGAGTACGACGACACGCGGCGCCTTCCTGCGGCTGTACCACCCGGAGGCGGCGGGCCAGGGGCAGCAG
GGCGGGTTCGCGAGCGGGATGGGGCGGCGGCGGCTGCTGGTGGGCGGAGCCATCTTCGGCGGGACGCTTCTGGCG
ATCAACGTCGTCTTCAACCGCGAGACGCGCGAGGACGGCGGGATGCCGGTGTACGAGCGCGACTACCTCAACAAC
ACGTTCCTGCACACCGGGCTCGGCATCGGCATCATCGGGCTGACGGCGCGGCAGATGGTGCAGTCGGGCTTCGTG
TACCGGCTGATGGTGACGAACCCGTGGGTGGTGGGGCTGGGGGGGTTGGCGCTGAGCTTTGCGACGATGATTGGG
ACGCGGTCCATCAGCCCGGACAACTACATACCCAAGTACGCCATGTGGACGGCCTTCAACGCGACGCAGGCGGCC
TTCGTGGCGCCGCTGCTGGCGTTCGTGCCGGTGCCGCTGCTGGCGCGGGCCGGCCTGTACACGGTGACGATGATG
GGCGCGCTGTCGGTGGTGGGGGCGACGGCCAAGCAGGAGAAGTACCTGTACATCGGCGGCCCGCTGCTGGCCGGG
GCGGCGCTGGTGGCGGCGTCGGGGCTGGCGCCGCTGGTGCTGCCGGTGACGGCGGTGCGGACGCTGGCGCTGACG
GAGAAGGTGTGGCTGTACGGCGGGCTGGCCGTCTTCGGCGGCTTCACGCTGTACGACGTGCAGAAGGTGCTGCAC
CACGCGCGGCTGGCCGAGGCCGGGTACATGCGGCGGGACCCGGTCAACGAGAGCATCGCGCTCGAGCTCGACTTT
CTGAACATTTTCGTGCGCATGGTGCAGATTCTGATGATGAGGCAGAACCAGCGGAAGTGA
Transcript >Hirsu2|10862
ATGTCGTTCATCCTCAGCGTGCGGCAGGGCCCGGTGCGGCTCGCGCATCGGCTCGCCGCGACGACGGTGCGGGCT
CCGGCGGCGGCGGCGCGCGGCCTCCACAAGGCCCCGAGCGGCGGCATGGCGCAGCGGGCGCGGACTCTGAAGGGC
GCGGGCGCGAGTACGACGACACGCGGCGCCTTCCTGCGGCTGTACCACCCGGAGGCGGCGGGCCAGGGGCAGCAG
GGCGGGTTCGCGAGCGGGATGGGGCGGCGGCGGCTGCTGGTGGGCGGAGCCATCTTCGGCGGGACGCTTCTGGCG
ATCAACGTCGTCTTCAACCGCGAGACGCGCGAGGACGGCGGGATGCCGGTGTACGAGCGCGACTACCTCAACAAC
ACGTTCCTGCACACCGGGCTCGGCATCGGCATCATCGGGCTGACGGCGCGGCAGATGGTGCAGTCGGGCTTCGTG
TACCGGCTGATGGTGACGAACCCGTGGGTGGTGGGGCTGGGGGGGTTGGCGCTGAGCTTTGCGACGATGATTGGG
ACGCGGTCCATCAGCCCGGACAACTACATACCCAAGTACGCCATGTGGACGGCCTTCAACGCGACGCAGGCGGCC
TTCGTGGCGCCGCTGCTGGCGTTCGTGCCGGTGCCGCTGCTGGCGCGGGCCGGCCTGTACACGGTGACGATGATG
GGCGCGCTGTCGGTGGTGGGGGCGACGGCCAAGCAGGAGAAGTACCTGTACATCGGCGGCCCGCTGCTGGCCGGG
GCGGCGCTGGTGGCGGCGTCGGGGCTGGCGCCGCTGGTGCTGCCGGTGACGGCGGTGCGGACGCTGGCGCTGACG
GAGAAGGTGTGGCTGTACGGCGGGCTGGCCGTCTTCGGCGGCTTCACGCTGTACGACGTGCAGAAGGTGCTGCAC
CACGCGCGGCTGGCCGAGGCCGGGTACATGCGGCGGGACCCGGTCAACGAGAGCATCGCGCTCGAGCTCGACTTT
CTGAACATTTTCGTGCGCATGGTGCAGATTCTGATGATGAGGCAGAACCAGCGGAAGTGA
Gene >Hirsu2|10862
ATGTCGTTCATCCTCAGCGTGCGGCAGGGCCCGGTGCGGCTCGCGCATCGGCTCGCCGCGACGACGGTGCGGGCT
CCGGCGGCGGCGGCGCGCGGCCTCCACAAGGCCCCGAGCGGCGGCATGGCGCAGCGGGCGCGGACTCTGAAGGGC
GCGGGCGCGAGTACGACGACACGCGGCGCCTTCCTGCGGCTGTACCACCCGGAGGCGGCGGGCCAGGGGCAGCAG
GGCGGGTTCGCGAGCGGGATGGGGCGGCGGCGGCTGCTGGTGGGCGGAGCCATCTTCGGCGGGACGCTTCTGGCG
ATCAACGTCGTCTTCAACCGCGAGACGCGCGAGGACGGCGGGATGCCGGTGTACGAGCGCGACTACCTCAACAAC
ACGTTCCTGCACACCGGGCTCGGCATCGGCATCATCGGGCTGACGGCGCGGCAGATGGTGCAGTCGGGCTTCGTG
TACCGGCTGATGGTGACGAACCCGTGGGTGGTGGGGCTGGGGGGGTTGGCGCTGAGCTTTGCGACGATGATTGGG
ACGCGGTCCATCAGCCCGGACAAGTGAGTTTCTCCCCCTCTTGTCTGTCACTCTCTCGGAAGAGGGTGTGAAGGT
GTCTCGTCGCCCTCTACTGACGGCACGGCTCAGCTACATACCCAAGTACGCCATGTGGACGGCCTTCAACGCGAC
GCAGGCGGCCTTCGTGGCGCCGCTGCTGGCGTTCGTGCCGGTGCCGCTGCTGGCGCGGGCCGGCCTGTACACGGT
GACGATGATGGGCGCGCTGTCGGTGGTGGGGGCGACGGCCAAGCAGGAGAAGTACCTGTACATCGGCGGCCCGCT
GCTGGCCGGGGCGGCGCTGGTGGCGGCGTCGGGGCTGGCGCCGCTGGTGCTGCCGGTGACGGCGGTGCGGACGCT
GGCGCTGACGGAGAAGGTGTGGCTGTACGGCGGGCTGGCCGTCTTCGGCGGCTTCACGCTGTACGACGTGCAGAA
GGTGCTGCACCACGCGCGGCTGGCCGAGGCCGGGTACATGCGGCGGGACCCGGTCAACGAGAGCATCGCGCTCGA
GCTCGACTTTCTGAACATTTTCGTGCGCATGGTGCAGATTCTGATGATGAGGCAGAACCAGCGGAAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail