Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1086
Gene name
LocationContig_1228:3241..4476
Strand-
Gene length (bp)1235
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11754 Velvet Velvet factor 3.9E-09 64 126
PF11754 Velvet Velvet factor 3.2E-34 126 242

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1086
MASNAGSYLDLPFLQPGRHSSSLQYLGGGGGGGGGGGGGGGELSLASDDTASQQAESYGDPQRQLTLRQAPMHAR
VAIGKEKDRKPIDPPPIVQLLDKRHNGKSGLYDSPYLFMTSSLVPENYGESSPSSSSGSSKEQELPSNYLVGSLV
SSIHRLRDTDNVEGGFFVFGDLSVKREGRFRLRFTLYERDQHSSAPSFYFVSELVTNVFTVFSTKLFPGMADSTQ
LTRTFSNQGVKVRLRKDSSGMAARKRNRGVTDVADDFLDRQTKRASYDRELPLNNYGVSELMDPLHGVVSSAPPN
SFLVAADAMSSSSSTSSRNAGLGIPLSTSGYYFTGAHYY*
Coding >Hirsu2|1086
ATGGCCAGCAACGCCGGCAGCTACCTAGACCTGCCCTTCCTGCAGCCCGGCCGCCACTCGTCCAGCCTGCAGTAC
CTGGGCGGTGGCGGCGGCGGCGGCGGAGGCGGCGGCGGCGGCGGCGGCGAGCTGTCTCTGGCGAGCGACGACACC
GCCTCGCAGCAGGCCGAGTCGTACGGCGATCCCCAGCGGCAGCTGACGCTCAGGCAAGCGCCAATGCACGCACGA
GTGGCCATAGGAAAGGAGAAGGACCGCAAACCGATCGATCCTCCGCCCATCGTCCAGCTGCTCGACAAGCGACAC
AATGGGAAGAGCGGCCTCTACGACAGCCCCTATCTGTTCATGACGTCGTCGCTGGTACCGGAAAACTACGGCGAG
TCGTCGCCGTCCAGCAGCAGCGGCAGCAGCAAAGAGCAGGAGCTCCCGTCCAACTACCTCGTCGGCTCGCTCGTC
TCGTCGATCCACCGGCTGAGGGACACGGACAACGTCGAGGGCGGCTTCTTCGTCTTCGGCGACCTGTCGGTGAAG
CGCGAGGGCCGGTTCCGGCTCCGGTTCACGCTGTACGAGCGCGACCAGCACAGCTCGGCGCCCAGCTTCTACTTC
GTCTCGGAGCTGGTGACCAACGTCTTCACCGTCTTCTCCACCAAGCTCTTCCCCGGCATGGCCGACTCGACGCAG
TTGACGCGCACCTTCAGCAACCAGGGCGTCAAGGTCCGGCTCCGCAAGGACTCGAGCGGCATGGCGGCCAGGAAG
CGCAACCGGGGCGTCACCGACGTGGCCGACGACTTCCTCGACCGACAGACGAAGCGGGCCTCGTACGACCGGGAA
CTCCCGCTCAACAACTACGGCGTCTCCGAACTGATGGACCCCCTTCACGGCGTCGTCAGCTCGGCCCCGCCCAAC
AGCTTCCTCGTGGCCGCCGACGCCATGTCATCGTCCTCGTCGACGTCATCGAGGAACGCCGGCCTCGGGATACCG
CTGTCGACGAGCGGATACTACTTCACCGGCGCGCACTATTACTAG
Transcript >Hirsu2|1086
ATGGCCAGCAACGCCGGCAGCTACCTAGACCTGCCCTTCCTGCAGCCCGGCCGCCACTCGTCCAGCCTGCAGTAC
CTGGGCGGTGGCGGCGGCGGCGGCGGAGGCGGCGGCGGCGGCGGCGGCGAGCTGTCTCTGGCGAGCGACGACACC
GCCTCGCAGCAGGCCGAGTCGTACGGCGATCCCCAGCGGCAGCTGACGCTCAGGCAAGCGCCAATGCACGCACGA
GTGGCCATAGGAAAGGAGAAGGACCGCAAACCGATCGATCCTCCGCCCATCGTCCAGCTGCTCGACAAGCGACAC
AATGGGAAGAGCGGCCTCTACGACAGCCCCTATCTGTTCATGACGTCGTCGCTGGTACCGGAAAACTACGGCGAG
TCGTCGCCGTCCAGCAGCAGCGGCAGCAGCAAAGAGCAGGAGCTCCCGTCCAACTACCTCGTCGGCTCGCTCGTC
TCGTCGATCCACCGGCTGAGGGACACGGACAACGTCGAGGGCGGCTTCTTCGTCTTCGGCGACCTGTCGGTGAAG
CGCGAGGGCCGGTTCCGGCTCCGGTTCACGCTGTACGAGCGCGACCAGCACAGCTCGGCGCCCAGCTTCTACTTC
GTCTCGGAGCTGGTGACCAACGTCTTCACCGTCTTCTCCACCAAGCTCTTCCCCGGCATGGCCGACTCGACGCAG
TTGACGCGCACCTTCAGCAACCAGGGCGTCAAGGTCCGGCTCCGCAAGGACTCGAGCGGCATGGCGGCCAGGAAG
CGCAACCGGGGCGTCACCGACGTGGCCGACGACTTCCTCGACCGACAGACGAAGCGGGCCTCGTACGACCGGGAA
CTCCCGCTCAACAACTACGGCGTCTCCGAACTGATGGACCCCCTTCACGGCGTCGTCAGCTCGGCCCCGCCCAAC
AGCTTCCTCGTGGCCGCCGACGCCATGTCATCGTCCTCGTCGACGTCATCGAGGAACGCCGGCCTCGGGATACCG
CTGTCGACGAGCGGATACTACTTCACCGGCGCGCACTATTACTAG
Gene >Hirsu2|1086
ATGGCCAGCAACGCCGGCAGCTACCTAGACCTGCCCTTCCTGCAGCCCGGCCGCCACTCGTCCAGCCTGCAGTAC
CTGGGCGGTGGCGGCGGCGGCGGCGGAGGCGGCGGCGGCGGCGGCGGCGAGCTGTCTCTGGCGAGCGACGACACC
GCCTCGCAGCAGGCCGAGTCGTACGGCGATCCCCAGCGGCAGCTGACGCTCAGGCAAGCGCCAATGCACGCACGA
GTGGCCATAGGAAAGGAGAAGGGTGCGTGCCCCGACTTTTGAGGGGGGGGGGGCAGTTTTCGTGGTTCGGAGAGG
CTAACGCGGCGCATCTAGACCGCAAACCGATCGATCCTCCGCCCATCGTCCAGCTGCTCGACAAGCGACACAATG
GGAAGAGCGGCCTCTACGACAGTCAGTATCCCCTGCTCTCCCTCCCTCCCCTCCCTCACCCCCTCTCCCATCCAC
GCATCACCCCGTCTCTCTCTTGCCGCTCTGCTCTCTCCCCTCTCGCGACGCGGTGCCGAATGCGATTCTCACCCG
CCCGTTCTCGCGCAGGCCCCTATCTGTTCATGACGTCGTCGCTGGTACCGGAAAACTACGGCGAGTCGTCGCCGT
CCAGCAGCAGCGGCAGCAGCAAAGAGCAGGAGCTCCCGTCCAACTACCTCGTCGGCTCGCTCGTCTCGTCGATCC
ACCGGCTGAGGGACACGGACAACGTCGAGGGCGGCTTCTTCGTCTTCGGCGACCTGTCGGTGAAGCGCGAGGGCC
GGTTCCGGCTCCGGTTCACGCTGTACGAGCGCGACCAGCACAGCTCGGCGCCCAGCTTCTACTTCGTCTCGGAGC
TGGTGACCAACGTCTTCACCGTCTTCTCCACCAAGCTCTTCCCCGGCATGGCCGACTCGACGCAGTTGACGCGCA
CCTTCAGCAACCAGGGCGTCAAGGTCCGGCTCCGCAAGGACTCGAGCGGCATGGCGGCCAGGAAGCGCAACCGGG
GCGTCACCGACGTGGCCGACGACTTCCTCGACCGACAGACGAAGCGGGCCTCGTACGACCGGGAACTCCCGCTCA
ACAACTACGGCGTCTCCGAACTGATGGACCCCCTTCACGGCGTCGTCAGCTCGGCCCCGCCCAACAGCTTCCTCG
TGGCCGCCGACGCCATGTCATCGTCCTCGTCGACGTCATCGAGGAACGCCGGCCTCGGGATACCGCTGTCGACGA
GCGGATACTACTTCACCGGCGCGCACTATTACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail