Protein ID | Hirsu2|1085 |
Gene name | |
Location | Contig_1227:2739..6466 |
Strand | - |
Gene length (bp) | 3727 |
Transcript length (bp) | 3357 |
Coding sequence length (bp) | 3357 |
Protein length (aa) | 1119 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00400 | WD40 | WD domain, G-beta repeat | 5.8E-02 | 734 | 765 |
PF00400 | WD40 | WD domain, G-beta repeat | 4.0E-05 | 771 | 805 |
PF00400 | WD40 | WD domain, G-beta repeat | 3.8E-04 | 811 | 862 |
PF00400 | WD40 | WD domain, G-beta repeat | 4.5E-05 | 888 | 920 |
PF00400 | WD40 | WD domain, G-beta repeat | 3.0E-04 | 926 | 963 |
PF00400 | WD40 | WD domain, G-beta repeat | 1.7E-03 | 967 | 1003 |
PF00400 | WD40 | WD domain, G-beta repeat | 2.6E-04 | 1007 | 1042 |
PF12937 | F-box-like | F-box-like | 3.2E-10 | 527 | 571 |
PF00646 | F-box | F-box domain | 1.1E-09 | 527 | 563 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 708 | 1090 | 2.0E-121 |
sp|P53699|CDC4_CANAX | Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 | 700 | 1086 | 3.0E-121 |
sp|P87060|POP1_SCHPO | WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 | 701 | 1090 | 3.0E-105 |
sp|P07834|CDC4_YEAST | Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 | 717 | 1086 | 7.0E-94 |
sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 708 | 1086 | 7.0E-77 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 708 | 1090 | 2.0E-121 |
sp|P53699|CDC4_CANAX | Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 | 700 | 1086 | 3.0E-121 |
sp|P87060|POP1_SCHPO | WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 | 701 | 1090 | 3.0E-105 |
sp|P07834|CDC4_YEAST | Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 | 717 | 1086 | 7.0E-94 |
sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 708 | 1086 | 7.0E-77 |
sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 708 | 1086 | 2.0E-76 |
sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 708 | 1086 | 3.0E-76 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 708 | 1086 | 6.0E-76 |
sp|Q93794|SEL10_CAEEL | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans GN=sel-10 PE=1 SV=3 | 685 | 1089 | 8.0E-65 |
sp|Q61FW2|SEL10_CAEBR | F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis briggsae GN=sel-10 PE=3 SV=1 | 709 | 1088 | 1.0E-62 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 486 | 1035 | 3.0E-47 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 486 | 1035 | 5.0E-47 |
sp|Q09990|LIN23_CAEEL | F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 | 696 | 1042 | 3.0E-45 |
sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 479 | 1041 | 7.0E-45 |
sp|Q0CY32|SCONB_ASPTN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 | 482 | 1048 | 9.0E-45 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 748 | 1052 | 2.0E-44 |
sp|B8NGT5|SCONB_ASPFN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 | 486 | 1044 | 2.0E-44 |
sp|Q2UFN8|SCONB_ASPOR | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 | 486 | 1044 | 2.0E-44 |
sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 486 | 1048 | 3.0E-42 |
sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 486 | 1048 | 3.0E-42 |
sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 707 | 1042 | 5.0E-42 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 752 | 1052 | 8.0E-42 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 748 | 1068 | 1.0E-41 |
sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 486 | 1048 | 1.0E-41 |
sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 707 | 1042 | 2.0E-41 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 696 | 1065 | 2.0E-41 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 748 | 1065 | 2.0E-41 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 748 | 1052 | 6.0E-41 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 752 | 1052 | 7.0E-41 |
sp|B6GZA1|SCONB_PENRW | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 | 395 | 1003 | 7.0E-41 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 486 | 1045 | 8.0E-41 |
sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 707 | 1043 | 8.0E-41 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 486 | 1048 | 1.0E-40 |
sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 707 | 1043 | 1.0E-40 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 748 | 1052 | 1.0E-40 |
sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 707 | 1042 | 2.0E-40 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 696 | 1065 | 3.0E-40 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 752 | 1052 | 9.0E-40 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 752 | 1052 | 1.0E-39 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 748 | 1064 | 2.0E-39 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 750 | 1065 | 7.0E-39 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 748 | 1064 | 5.0E-38 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 748 | 1077 | 7.0E-38 |
sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 765 | 1052 | 8.0E-38 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 761 | 1068 | 1.0E-35 |
sp|Q969H0|FBXW7_HUMAN | F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 | 480 | 973 | 4.0E-35 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 752 | 1052 | 5.0E-35 |
sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 740 | 1041 | 7.0E-35 |
sp|Q8VBV4|FBXW7_MOUSE | F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 | 480 | 973 | 1.0E-34 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 708 | 1048 | 5.0E-33 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 708 | 1045 | 1.0E-32 |
sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 513 | 1046 | 1.0E-32 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 755 | 1064 | 2.0E-32 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 739 | 1045 | 2.0E-32 |
sp|P39014|MET30_YEAST | F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 | 708 | 1013 | 3.0E-31 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 677 | 1048 | 4.0E-31 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 677 | 1048 | 4.0E-31 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 752 | 1044 | 4.0E-31 |
sp|Q7S8R5|MDV1_NEUCR | Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 | 769 | 1076 | 4.0E-31 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 486 | 1035 | 5.0E-31 |
sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 752 | 1044 | 8.0E-31 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 752 | 1044 | 1.0E-30 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 752 | 1044 | 1.0E-30 |
sp|P40042|RRT13_YEAST | Regulator of rDNA transcription protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRT13 PE=3 SV=1 | 928 | 1086 | 2.0E-30 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 752 | 1044 | 2.0E-30 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 752 | 1044 | 2.0E-30 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 752 | 1044 | 2.0E-30 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 752 | 1044 | 2.0E-30 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 752 | 1044 | 3.0E-30 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 758 | 1045 | 3.0E-30 |
sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 752 | 1044 | 3.0E-30 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 752 | 1044 | 4.0E-30 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 752 | 1044 | 4.0E-30 |
sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 752 | 1044 | 4.0E-30 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 752 | 1044 | 5.0E-30 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 728 | 1043 | 6.0E-30 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 729 | 1044 | 6.0E-30 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 752 | 1044 | 1.0E-29 |
sp|A7ETB3|MDV1_SCLS1 | Mitochondrial division protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdv1 PE=3 SV=1 | 773 | 1111 | 1.0E-29 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 748 | 1047 | 1.0E-29 |
sp|Q1DIW7|MDV1_COCIM | Mitochondrial division protein 1 OS=Coccidioides immitis (strain RS) GN=MDV1 PE=3 SV=2 | 769 | 1076 | 1.0E-29 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 752 | 1044 | 2.0E-29 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 728 | 1044 | 2.0E-29 |
sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 782 | 1078 | 4.0E-29 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 722 | 1044 | 4.0E-29 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 752 | 1044 | 4.0E-29 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 752 | 1044 | 4.0E-29 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 771 | 1052 | 1.0E-28 |
sp|Q2H139|MDV1_CHAGB | Mitochondrial division protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDV1 PE=3 SV=2 | 769 | 1076 | 2.0E-28 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 752 | 1044 | 3.0E-28 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 486 | 1002 | 5.0E-28 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 752 | 1044 | 6.0E-28 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 752 | 1044 | 8.0E-28 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 711 | 1064 | 1.0E-27 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 752 | 1044 | 1.0E-27 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 752 | 1044 | 1.0E-27 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 752 | 1044 | 1.0E-27 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 752 | 1044 | 1.0E-27 |
sp|Q0CJD8|MDV1_ASPTN | Mitochondrial division protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdv1 PE=3 SV=2 | 769 | 1072 | 2.0E-27 |
sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 729 | 1044 | 2.0E-27 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 752 | 1044 | 2.0E-27 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 752 | 1044 | 2.0E-27 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 752 | 1044 | 2.0E-27 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 771 | 1052 | 2.0E-27 |
sp|F1MNN4|FBXW7_BOVIN | F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 | 480 | 931 | 3.0E-27 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 486 | 1002 | 3.0E-27 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 486 | 1002 | 3.0E-27 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 733 | 1039 | 3.0E-27 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 752 | 1044 | 3.0E-27 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 752 | 1044 | 3.0E-27 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 732 | 1072 | 4.0E-27 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 752 | 1044 | 5.0E-27 |
sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 752 | 1044 | 6.0E-27 |
sp|A2R3Z3|MDV1_ASPNC | Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2 | 773 | 1072 | 8.0E-27 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 739 | 1041 | 9.0E-27 |
sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 837 | 1095 | 1.0E-26 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 727 | 1041 | 1.0E-26 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 727 | 1041 | 1.0E-26 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 727 | 1041 | 1.0E-26 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 727 | 1041 | 1.0E-26 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 752 | 1044 | 1.0E-26 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 770 | 1052 | 1.0E-26 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 752 | 1044 | 1.0E-26 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 751 | 1016 | 2.0E-26 |
sp|A8PTE4|MDV1_MALGO | Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1 | 792 | 1072 | 2.0E-26 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 752 | 1023 | 2.0E-26 |
sp|P87053|POF1_SCHPO | F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof1 PE=1 SV=1 | 809 | 1072 | 3.0E-26 |
sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 781 | 1085 | 4.0E-26 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 771 | 1052 | 4.0E-26 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 727 | 1045 | 4.0E-26 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 771 | 1052 | 4.0E-26 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 893 | 1064 | 5.0E-26 |
sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 849 | 1048 | 5.0E-26 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 752 | 1023 | 5.0E-26 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 771 | 1052 | 5.0E-26 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 727 | 1041 | 5.0E-26 |
sp|Q6CJ50|MDV1_KLULA | Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1 | 759 | 1051 | 7.0E-26 |
sp|A1CBP8|MDV1_ASPCL | Mitochondrial division protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdv1 PE=3 SV=1 | 769 | 1118 | 1.0E-25 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 771 | 1052 | 3.0E-25 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 798 | 1047 | 5.0E-25 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 771 | 1052 | 5.0E-25 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 771 | 1052 | 5.0E-25 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 771 | 1052 | 5.0E-25 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 771 | 1052 | 5.0E-25 |
sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 843 | 1047 | 5.0E-25 |
sp|A1DDL6|MDV1_NEOFI | Mitochondrial division protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdv1 PE=3 SV=1 | 769 | 1072 | 5.0E-25 |
sp|Q4WVS4|MDV1_ASPFU | Mitochondrial division protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdv1 PE=3 SV=2 | 769 | 1072 | 5.0E-25 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 770 | 1052 | 6.0E-25 |
sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 772 | 1043 | 7.0E-25 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 790 | 1052 | 8.0E-25 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 791 | 1052 | 8.0E-25 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 791 | 1052 | 8.0E-25 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 778 | 1064 | 1.0E-24 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 770 | 1052 | 1.0E-24 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 748 | 1002 | 2.0E-24 |
sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 772 | 1043 | 2.0E-24 |
sp|P53699|CDC4_CANAX | Cell division control protein 4 OS=Candida albicans GN=CDC4 PE=3 SV=1 | 476 | 968 | 3.0E-24 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 752 | 1030 | 3.0E-24 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 752 | 1030 | 3.0E-24 |
sp|Q0U2T3|MDV1_PHANO | Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 | 767 | 1046 | 3.0E-24 |
sp|Q6Q0C0|TRAF7_HUMAN | E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 | 744 | 1041 | 3.0E-24 |
sp|Q8WWQ0|PHIP_HUMAN | PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 | 742 | 1058 | 3.0E-24 |
sp|A7THX0|MDV1_VANPO | Mitochondrial division protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDV1 PE=3 SV=1 | 776 | 1072 | 3.0E-24 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 852 | 1055 | 4.0E-24 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 775 | 1052 | 5.0E-24 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 732 | 1041 | 5.0E-24 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 850 | 1065 | 6.0E-24 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 737 | 1043 | 6.0E-24 |
sp|Q922B6|TRAF7_MOUSE | E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 | 744 | 1041 | 6.0E-24 |
sp|Q758R7|MDV1_ASHGO | Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1 | 655 | 1042 | 6.0E-24 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 850 | 1072 | 7.0E-24 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 741 | 1044 | 7.0E-24 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 891 | 1055 | 7.0E-24 |
sp|Q8VDD9|PHIP_MOUSE | PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 | 742 | 1058 | 7.0E-24 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 775 | 1052 | 8.0E-24 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 741 | 1049 | 8.0E-24 |
sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 837 | 1085 | 9.0E-24 |
sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 837 | 1095 | 9.0E-24 |
sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 837 | 1085 | 1.0E-23 |
sp|P90648|MHCKB_DICDI | Myosin heavy chain kinase B OS=Dictyostelium discoideum GN=mhkB PE=2 SV=1 | 790 | 1077 | 1.0E-23 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 891 | 1055 | 1.0E-23 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 891 | 1055 | 1.0E-23 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 891 | 1055 | 1.0E-23 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 772 | 1053 | 1.0E-23 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 888 | 1062 | 2.0E-23 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 900 | 1052 | 2.0E-23 |
sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 750 | 1003 | 2.0E-23 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 748 | 1006 | 2.0E-23 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 733 | 1042 | 2.0E-23 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 770 | 1052 | 2.0E-23 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 752 | 1041 | 3.0E-23 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 891 | 1053 | 3.0E-23 |
sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 742 | 1041 | 3.0E-23 |
sp|O43660|PLRG1_HUMAN | Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 | 770 | 1065 | 3.0E-23 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 888 | 1062 | 4.0E-23 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 886 | 1052 | 4.0E-23 |
sp|Q2KID6|PLRG1_BOVIN | Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 | 770 | 1065 | 4.0E-23 |
sp|O43660|PLRG1_HUMAN | Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 | 742 | 1041 | 4.0E-23 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 888 | 1062 | 5.0E-23 |
sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 748 | 1000 | 5.0E-23 |
sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 889 | 1062 | 7.0E-23 |
sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 889 | 1062 | 7.0E-23 |
sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 748 | 1006 | 7.0E-23 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 888 | 1062 | 1.0E-22 |
sp|Q09990|LIN23_CAEEL | F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 | 837 | 1085 | 1.0E-22 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 843 | 1053 | 1.0E-22 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 843 | 1065 | 1.0E-22 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 790 | 1052 | 1.0E-22 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 886 | 1052 | 1.0E-22 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 891 | 1055 | 1.0E-22 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 752 | 1041 | 1.0E-22 |
sp|B8NGT5|SCONB_ASPFN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 | 889 | 1062 | 2.0E-22 |
sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 888 | 1062 | 2.0E-22 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 890 | 1062 | 2.0E-22 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 890 | 1062 | 2.0E-22 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 890 | 1062 | 2.0E-22 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 790 | 1052 | 2.0E-22 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 889 | 1081 | 2.0E-22 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 752 | 1041 | 2.0E-22 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 644 | 1052 | 2.0E-22 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 772 | 1064 | 2.0E-22 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 891 | 1055 | 2.0E-22 |
sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 748 | 1006 | 2.0E-22 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 756 | 1044 | 2.0E-22 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 888 | 1062 | 3.0E-22 |
sp|Q2UFN8|SCONB_ASPOR | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 | 889 | 1062 | 3.0E-22 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 843 | 1053 | 3.0E-22 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 840 | 1053 | 3.0E-22 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 889 | 1081 | 3.0E-22 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 891 | 1055 | 3.0E-22 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 790 | 1052 | 4.0E-22 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 790 | 1052 | 4.0E-22 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 790 | 1052 | 4.0E-22 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 790 | 1052 | 4.0E-22 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 790 | 1052 | 4.0E-22 |
sp|Q9WUC8|PLRG1_RAT | Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 | 770 | 1065 | 4.0E-22 |
sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 743 | 976 | 4.0E-22 |
sp|Q0CY32|SCONB_ASPTN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 | 889 | 1062 | 5.0E-22 |
sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 741 | 1020 | 5.0E-22 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 734 | 1041 | 5.0E-22 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 828 | 1053 | 6.0E-22 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 790 | 1052 | 7.0E-22 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 792 | 1052 | 7.0E-22 |
sp|Q9NSI6|BRWD1_HUMAN | Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 | 742 | 1115 | 7.0E-22 |
sp|A6ZZZ8|CAF4_YEAS7 | CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=CAF4 PE=3 SV=2 | 778 | 1067 | 7.0E-22 |
sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 729 | 1024 | 7.0E-22 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 843 | 1053 | 8.0E-22 |
sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 772 | 1052 | 8.0E-22 |
sp|P36130|CAF4_YEAST | CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF4 PE=1 SV=3 | 778 | 1067 | 8.0E-22 |
sp|Q6GM65|PLAP_XENLA | Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2 | 770 | 1060 | 8.0E-22 |
sp|Q922V4|PLRG1_MOUSE | Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 | 770 | 1065 | 8.0E-22 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 734 | 1041 | 8.0E-22 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 790 | 1052 | 9.0E-22 |
sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 744 | 976 | 9.0E-22 |
sp|P47025|MDV1_YEAST | Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 | 759 | 1050 | 9.0E-22 |
sp|P0CS44|MDV1_CRYNJ | Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MDV1 PE=3 SV=1 | 726 | 1071 | 9.0E-22 |
sp|P0CS45|MDV1_CRYNB | Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MDV1 PE=3 SV=1 | 726 | 1071 | 9.0E-22 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 752 | 982 | 1.0E-21 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 790 | 1052 | 1.0E-21 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 840 | 1053 | 1.0E-21 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 748 | 1002 | 1.0E-21 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 748 | 1002 | 1.0E-21 |
sp|Q9WUC8|PLRG1_RAT | Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 | 742 | 1041 | 1.0E-21 |
sp|Q921C3|BRWD1_MOUSE | Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 | 742 | 1115 | 1.0E-21 |
sp|A6ZQL5|MDV1_YEAS7 | Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 | 759 | 1050 | 1.0E-21 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 773 | 1052 | 1.0E-21 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 843 | 1053 | 2.0E-21 |
sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 790 | 1052 | 2.0E-21 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 790 | 1052 | 2.0E-21 |
sp|Q922V4|PLRG1_MOUSE | Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 | 742 | 1041 | 2.0E-21 |
sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 750 | 1006 | 2.0E-21 |
sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 771 | 1052 | 2.0E-21 |
sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 748 | 1006 | 2.0E-21 |
sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 762 | 1006 | 2.0E-21 |
sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 762 | 1006 | 2.0E-21 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 729 | 1024 | 2.0E-21 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 790 | 1052 | 3.0E-21 |
sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 840 | 1053 | 3.0E-21 |
sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 840 | 1090 | 3.0E-21 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 748 | 1002 | 3.0E-21 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 722 | 1004 | 3.0E-21 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 722 | 1004 | 3.0E-21 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 891 | 1055 | 3.0E-21 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 878 | 1055 | 3.0E-21 |
sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 742 | 975 | 3.0E-21 |
sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 729 | 1024 | 3.0E-21 |
sp|Q5XX13|FBW10_HUMAN | F-box/WD repeat-containing protein 10 OS=Homo sapiens GN=FBXW10 PE=2 SV=2 | 745 | 1041 | 3.0E-21 |
sp|Q9P7I3|MDV1_SCHPO | Mitochondrial division protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdv1 PE=3 SV=1 | 768 | 1042 | 4.0E-21 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 733 | 1041 | 4.0E-21 |
sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 748 | 1006 | 4.0E-21 |
sp|P42527|MHCKA_DICDI | Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 | 747 | 1042 | 4.0E-21 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 772 | 1052 | 5.0E-21 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 748 | 1005 | 5.0E-21 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 887 | 1076 | 5.0E-21 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 748 | 1006 | 5.0E-21 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 742 | 962 | 5.0E-21 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 729 | 1024 | 5.0E-21 |
sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 722 | 1041 | 5.0E-21 |
sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 775 | 1083 | 5.0E-21 |
sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 762 | 1006 | 5.0E-21 |
sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 762 | 1006 | 5.0E-21 |
sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 729 | 1024 | 6.0E-21 |
sp|Q4P8R5|MDV1_USTMA | Mitochondrial division protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDV1 PE=3 SV=1 | 726 | 1072 | 6.0E-21 |
sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 775 | 1052 | 7.0E-21 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 770 | 1050 | 7.0E-21 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 887 | 1041 | 8.0E-21 |
sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 756 | 1044 | 8.0E-21 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 790 | 1052 | 9.0E-21 |
sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 762 | 1006 | 9.0E-21 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 886 | 1046 | 1.0E-20 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 742 | 1041 | 1.0E-20 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 741 | 1002 | 1.0E-20 |
sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 750 | 1006 | 1.0E-20 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 766 | 1081 | 1.0E-20 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 789 | 1048 | 1.0E-20 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 734 | 1041 | 1.0E-20 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 751 | 1041 | 1.0E-20 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 766 | 1081 | 1.0E-20 |
sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 840 | 1053 | 2.0E-20 |
sp|B3S4I5|LIS1_TRIAD | Lissencephaly-1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_50647 PE=3 SV=1 | 841 | 1053 | 2.0E-20 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 754 | 1041 | 2.0E-20 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 754 | 1041 | 2.0E-20 |
sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 752 | 1002 | 2.0E-20 |
sp|P38129|TAF5_YEAST | Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 | 742 | 1064 | 2.0E-20 |
sp|Q6CB13|MDV1_YARLI | Mitochondrial division protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDV1 PE=3 SV=1 | 817 | 1071 | 2.0E-20 |
sp|A2AHJ4|BRWD3_MOUSE | Bromodomain and WD repeat-containing protein 3 OS=Mus musculus GN=Brwd3 PE=1 SV=1 | 742 | 1064 | 2.0E-20 |
sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 748 | 1006 | 2.0E-20 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 771 | 1052 | 2.0E-20 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 840 | 1053 | 3.0E-20 |
sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 790 | 1050 | 3.0E-20 |
sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 743 | 1002 | 3.0E-20 |
sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 743 | 1002 | 3.0E-20 |
sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 734 | 1041 | 3.0E-20 |
sp|P49026|GBLP_TOBAC | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana tabacum GN=ARCA PE=2 SV=1 | 748 | 1006 | 3.0E-20 |
sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 748 | 1041 | 3.0E-20 |
sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 770 | 1054 | 3.0E-20 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 881 | 1049 | 4.0E-20 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 840 | 1064 | 4.0E-20 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 770 | 1052 | 4.0E-20 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 913 | 1068 | 5.0E-20 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 748 | 1002 | 5.0E-20 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 887 | 1072 | 5.0E-20 |
sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 748 | 1006 | 5.0E-20 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 840 | 1053 | 6.0E-20 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 840 | 1053 | 6.0E-20 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 840 | 1053 | 6.0E-20 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 840 | 1053 | 6.0E-20 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 840 | 1053 | 6.0E-20 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 840 | 1053 | 6.0E-20 |
sp|Q6RI45|BRWD3_HUMAN | Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens GN=BRWD3 PE=1 SV=2 | 742 | 1064 | 6.0E-20 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 731 | 1077 | 6.0E-20 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 742 | 1041 | 7.0E-20 |
sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 752 | 1024 | 7.0E-20 |
sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 739 | 1024 | 7.0E-20 |
sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 772 | 1052 | 7.0E-20 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 748 | 1047 | 7.0E-20 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 840 | 1064 | 8.0E-20 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 840 | 1053 | 8.0E-20 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 775 | 1049 | 8.0E-20 |
sp|P27612|PLAP_MOUSE | Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4 | 770 | 1060 | 8.0E-20 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 840 | 1053 | 9.0E-20 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 772 | 1052 | 9.0E-20 |
sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 835 | 1053 | 9.0E-20 |
sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 722 | 1007 | 9.0E-20 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 888 | 1064 | 1.0E-19 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 840 | 1053 | 1.0E-19 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 734 | 1041 | 1.0E-19 |
sp|A7TNS8|CAF4_VANPO | CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1 | 777 | 1003 | 1.0E-19 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 731 | 1077 | 1.0E-19 |
sp|B6GZA1|SCONB_PENRW | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 | 888 | 1062 | 2.0E-19 |
sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 729 | 1024 | 2.0E-19 |
sp|Q9Y263|PLAP_HUMAN | Phospholipase A-2-activating protein OS=Homo sapiens GN=PLAA PE=1 SV=2 | 770 | 1060 | 2.0E-19 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 734 | 1002 | 2.0E-19 |
sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 772 | 1055 | 2.0E-19 |
sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 772 | 1055 | 2.0E-19 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 731 | 1077 | 2.0E-19 |
sp|P83774|GBLP_CANAL | Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 | 845 | 1052 | 2.0E-19 |
sp|P54319|PLAP_RAT | Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3 | 770 | 1060 | 2.0E-19 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 750 | 1042 | 2.0E-19 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 731 | 1077 | 2.0E-19 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 886 | 1062 | 3.0E-19 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 840 | 1053 | 3.0E-19 |
sp|Q0CJD8|MDV1_ASPTN | Mitochondrial division protein 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mdv1 PE=3 SV=2 | 738 | 1046 | 3.0E-19 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 888 | 1047 | 3.0E-19 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 792 | 1048 | 3.0E-19 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 778 | 1052 | 3.0E-19 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 807 | 1074 | 3.0E-19 |
sp|O95170|CDRT1_HUMAN | CMT1A duplicated region transcript 1 protein OS=Homo sapiens GN=CDRT1 PE=2 SV=3 | 745 | 1016 | 3.0E-19 |
sp|Q0U1B1|LIS1_PHANO | Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 | 792 | 1055 | 4.0E-19 |
sp|B2VWG7|LIS1_PYRTR | Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 | 792 | 1058 | 4.0E-19 |
sp|B6HP56|LIS11_PENRW | Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 | 772 | 1048 | 4.0E-19 |
sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 729 | 1024 | 4.0E-19 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 748 | 1047 | 4.0E-19 |
sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 748 | 1043 | 4.0E-19 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 731 | 1077 | 4.0E-19 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 840 | 1064 | 5.0E-19 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 891 | 1048 | 5.0E-19 |
sp|P42527|MHCKA_DICDI | Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 | 888 | 1049 | 5.0E-19 |
sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 732 | 1044 | 5.0E-19 |
sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 849 | 1047 | 6.0E-19 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 791 | 1052 | 6.0E-19 |
sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 771 | 1086 | 8.0E-19 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 771 | 1041 | 8.0E-19 |
sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 849 | 1047 | 9.0E-19 |
sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 729 | 1023 | 9.0E-19 |
sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 729 | 1023 | 9.0E-19 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 749 | 1047 | 9.0E-19 |
sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 790 | 1052 | 1.0E-18 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 792 | 1048 | 1.0E-18 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 886 | 1064 | 1.0E-18 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 752 | 1060 | 1.0E-18 |
sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 734 | 1041 | 1.0E-18 |
sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 792 | 1052 | 1.0E-18 |
sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 744 | 976 | 1.0E-18 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 897 | 1052 | 1.0E-18 |
sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 792 | 1052 | 1.0E-18 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 736 | 1052 | 1.0E-18 |
sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 732 | 1044 | 1.0E-18 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 822 | 1044 | 1.0E-18 |
sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 734 | 1024 | 1.0E-18 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 734 | 962 | 2.0E-18 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 740 | 965 | 2.0E-18 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 750 | 963 | 2.0E-18 |
sp|P42527|MHCKA_DICDI | Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 | 739 | 1006 | 2.0E-18 |
sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 734 | 1041 | 2.0E-18 |
sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 732 | 1044 | 2.0E-18 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 752 | 1060 | 2.0E-18 |
sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 729 | 1013 | 2.0E-18 |
sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 775 | 1044 | 2.0E-18 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 739 | 1024 | 2.0E-18 |
sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 734 | 1024 | 2.0E-18 |
sp|O62621|COPB2_DROME | Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 | 761 | 1013 | 2.0E-18 |
sp|Q20168|COPB2_CAEEL | Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 | 761 | 1024 | 2.0E-18 |
sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 729 | 1024 | 2.0E-18 |
sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 729 | 1024 | 2.0E-18 |
sp|Q6CKE8|PRP46_KLULA | Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 | 658 | 1041 | 2.0E-18 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 840 | 1072 | 3.0E-18 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 766 | 1072 | 3.0E-18 |
sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 729 | 1024 | 3.0E-18 |
sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 729 | 1024 | 3.0E-18 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 734 | 1076 | 3.0E-18 |
sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 738 | 1024 | 3.0E-18 |
sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 729 | 1024 | 3.0E-18 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 891 | 1052 | 4.0E-18 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 752 | 1002 | 4.0E-18 |
sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 744 | 1041 | 4.0E-18 |
sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 792 | 1020 | 4.0E-18 |
sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 756 | 1024 | 4.0E-18 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 891 | 1052 | 5.0E-18 |
sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 891 | 1058 | 5.0E-18 |
sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 751 | 1003 | 5.0E-18 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 727 | 1064 | 5.0E-18 |
sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 720 | 1024 | 5.0E-18 |
sp|Q9QXE7|TBL1X_MOUSE | F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 | 742 | 1003 | 5.0E-18 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 879 | 1055 | 6.0E-18 |
sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 792 | 1052 | 6.0E-18 |
sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 772 | 1052 | 7.0E-18 |
sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 850 | 1062 | 7.0E-18 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 887 | 1055 | 8.0E-18 |
sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 741 | 1020 | 8.0E-18 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 766 | 1059 | 8.0E-18 |
sp|Q2U5Z8|MDV1_ASPOR | Mitochondrial division protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mdv1 PE=3 SV=2 | 850 | 1072 | 8.0E-18 |
sp|Q9BQ87|TBL1Y_HUMAN | F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 | 742 | 1003 | 8.0E-18 |
sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 725 | 963 | 8.0E-18 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 802 | 1074 | 9.0E-18 |
sp|Q5AXW3|MDV1_EMENI | Mitochondrial division protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdv1 PE=3 SV=2 | 815 | 1072 | 9.0E-18 |
sp|Q09990|LIN23_CAEEL | F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans GN=lin-23 PE=1 SV=2 | 894 | 1116 | 1.0E-17 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 891 | 1052 | 1.0E-17 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 891 | 1052 | 1.0E-17 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 891 | 1052 | 1.0E-17 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 891 | 1052 | 1.0E-17 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 891 | 1052 | 1.0E-17 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 891 | 1052 | 1.0E-17 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 891 | 1052 | 1.0E-17 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 891 | 1052 | 1.0E-17 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 723 | 1041 | 1.0E-17 |
sp|Q5AXW3|MDV1_EMENI | Mitochondrial division protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdv1 PE=3 SV=2 | 734 | 1007 | 1.0E-17 |
sp|A4RJV3|MDV1_MAGO7 | Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 | 888 | 1076 | 1.0E-17 |
sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 843 | 1077 | 1.0E-17 |
sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 843 | 1077 | 1.0E-17 |
sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 792 | 1052 | 1.0E-17 |
sp|Q61011|GBB3_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 | 725 | 963 | 1.0E-17 |
sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 736 | 1024 | 1.0E-17 |
sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 772 | 1052 | 1.0E-17 |
sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 725 | 963 | 1.0E-17 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 732 | 962 | 2.0E-17 |
sp|Q09855|POF11_SCHPO | F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 | 897 | 1109 | 2.0E-17 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 891 | 1052 | 2.0E-17 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 750 | 1014 | 2.0E-17 |
sp|A8PTE4|MDV1_MALGO | Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1 | 742 | 1043 | 2.0E-17 |
sp|Q4WVS4|MDV1_ASPFU | Mitochondrial division protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdv1 PE=3 SV=2 | 741 | 1058 | 2.0E-17 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 885 | 1057 | 2.0E-17 |
sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 845 | 1044 | 2.0E-17 |
sp|Q9D994|WDR38_MOUSE | WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 | 784 | 1052 | 2.0E-17 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 791 | 1041 | 2.0E-17 |
sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 772 | 1048 | 2.0E-17 |
sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 772 | 1048 | 2.0E-17 |
sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 772 | 1048 | 2.0E-17 |
sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 748 | 1005 | 2.0E-17 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 750 | 974 | 2.0E-17 |
sp|Q75BY3|PRP46_ASHGO | Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 | 874 | 1052 | 2.0E-17 |
sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 765 | 1006 | 2.0E-17 |
sp|Q5ZJH5|WDR61_CHICK | WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 | 766 | 1081 | 2.0E-17 |
sp|P16520|GBB3_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 | 725 | 963 | 2.0E-17 |
sp|Q95RJ9|EBI_DROME | F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 | 742 | 1003 | 2.0E-17 |
sp|Q54R82|MKKA_DICDI | Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 | 887 | 1072 | 2.0E-17 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 732 | 962 | 3.0E-17 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 752 | 1060 | 3.0E-17 |
sp|P35606|COPB2_HUMAN | Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 | 790 | 1022 | 3.0E-17 |
sp|O55029|COPB2_MOUSE | Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 | 790 | 1022 | 3.0E-17 |
sp|P35605|COPB2_BOVIN | Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 | 790 | 1022 | 3.0E-17 |
sp|Q5R664|COPB2_PONAB | Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 | 790 | 1022 | 3.0E-17 |
sp|Q9H2Y7|ZN106_HUMAN | Zinc finger protein 106 OS=Homo sapiens GN=ZNF106 PE=1 SV=1 | 775 | 1023 | 3.0E-17 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 734 | 1076 | 3.0E-17 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 742 | 1078 | 4.0E-17 |
sp|P25387|GBLP_CHLRE | Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 | 825 | 1052 | 4.0E-17 |
sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 725 | 963 | 4.0E-17 |
sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 725 | 963 | 4.0E-17 |
sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 725 | 963 | 4.0E-17 |
sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 725 | 963 | 4.0E-17 |
sp|Q4R4I8|COPB2_MACFA | Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 | 790 | 1022 | 4.0E-17 |
sp|P38011|GBLP_YEAST | Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 | 844 | 1052 | 4.0E-17 |
sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 742 | 975 | 4.0E-17 |
sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 789 | 1072 | 4.0E-17 |
sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 850 | 1052 | 5.0E-17 |
sp|Q2U5Z8|MDV1_ASPOR | Mitochondrial division protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mdv1 PE=3 SV=2 | 741 | 1007 | 5.0E-17 |
sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 742 | 975 | 5.0E-17 |
sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 850 | 1062 | 5.0E-17 |
sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 850 | 1062 | 5.0E-17 |
sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 843 | 1062 | 5.0E-17 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 928 | 1065 | 6.0E-17 |
sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 891 | 1052 | 6.0E-17 |
sp|O74855|NLE1_SCHPO | Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 | 751 | 1072 | 6.0E-17 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 752 | 1055 | 6.0E-17 |
sp|Q6CB13|MDV1_YARLI | Mitochondrial division protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDV1 PE=3 SV=1 | 742 | 1003 | 6.0E-17 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 877 | 1052 | 7.0E-17 |
sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 849 | 1052 | 7.0E-17 |
sp|P52287|GBB3_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 | 725 | 963 | 7.0E-17 |
sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 850 | 1062 | 7.0E-17 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 756 | 1003 | 7.0E-17 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 791 | 1045 | 8.0E-17 |
sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 792 | 1052 | 8.0E-17 |
sp|Q6H8D6|COB23_ORYSJ | Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 | 792 | 1040 | 8.0E-17 |
sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 850 | 1062 | 8.0E-17 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 766 | 1035 | 9.0E-17 |
sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 792 | 1050 | 9.0E-17 |
sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 850 | 1062 | 9.0E-17 |
sp|Q6FT96|MDV1_CANGA | Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 | 776 | 1072 | 9.0E-17 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 731 | 1078 | 1.0E-16 |
sp|C5JD40|LIS1_AJEDS | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 | 739 | 1024 | 1.0E-16 |
sp|C5GVJ9|LIS1_AJEDR | Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 | 739 | 1024 | 1.0E-16 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 894 | 1090 | 1.0E-16 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 750 | 1060 | 1.0E-16 |
sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 736 | 1024 | 1.0E-16 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 751 | 1002 | 1.0E-16 |
sp|C4JPW9|LIS12_UNCRE | Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 | 771 | 1052 | 1.0E-16 |
sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 792 | 1052 | 1.0E-16 |
sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 843 | 1044 | 1.0E-16 |
sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 792 | 1052 | 1.0E-16 |
sp|Q6GMD2|WDR61_XENLA | WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 | 766 | 1081 | 1.0E-16 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 750 | 1054 | 1.0E-16 |
sp|B4KRQ4|WDR48_DROMO | WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 | 850 | 1062 | 1.0E-16 |
sp|Q6H8D5|COB22_ORYSJ | Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 | 792 | 1040 | 1.0E-16 |
sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 761 | 1040 | 1.0E-16 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 840 | 1109 | 2.0E-16 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 930 | 1065 | 2.0E-16 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 930 | 1065 | 2.0E-16 |
sp|Q0U2T3|MDV1_PHANO | Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 | 850 | 1072 | 2.0E-16 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 751 | 1003 | 2.0E-16 |
sp|P69104|GBLP_TRYBR | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 | 850 | 1052 | 2.0E-16 |
sp|P69103|GBLP_TRYBB | Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 | 850 | 1052 | 2.0E-16 |
sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 900 | 1077 | 2.0E-16 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 732 | 1002 | 2.0E-16 |
sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 792 | 1110 | 2.0E-16 |
sp|Q2HBX6|LIS11_CHAGB | Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 | 729 | 1024 | 2.0E-16 |
sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 772 | 1048 | 2.0E-16 |
sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 741 | 1020 | 2.0E-16 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 849 | 1072 | 2.0E-16 |
sp|Q95RJ9|EBI_DROME | F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 | 758 | 1081 | 2.0E-16 |
sp|Q05946|UTP13_YEAST | U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 | 771 | 1041 | 2.0E-16 |
sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 742 | 975 | 2.0E-16 |
sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 846 | 1044 | 2.0E-16 |
sp|Q6BU94|PRP46_DEBHA | Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 | 752 | 1041 | 2.0E-16 |
sp|Q8RXA7|SCD1_ARATH | DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 | 748 | 1042 | 2.0E-16 |
sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 742 | 975 | 2.0E-16 |
sp|Q00664|LIS1_EMENI | Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 | 728 | 1024 | 2.0E-16 |
sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 766 | 1081 | 2.0E-16 |
sp|Q9SJT9|COPA2_ARATH | Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 | 752 | 1008 | 2.0E-16 |
sp|Q9Y297|FBW1A_HUMAN | F-box/WD repeat-containing protein 1A OS=Homo sapiens GN=BTRC PE=1 SV=1 | 895 | 1116 | 3.0E-16 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 819 | 1052 | 3.0E-16 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 790 | 1049 | 3.0E-16 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 930 | 1065 | 3.0E-16 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 754 | 1041 | 3.0E-16 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 752 | 1002 | 3.0E-16 |
sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 736 | 1024 | 3.0E-16 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 789 | 1048 | 3.0E-16 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 771 | 1084 | 3.0E-16 |
sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 850 | 1062 | 3.0E-16 |
sp|O60907|TBL1X_HUMAN | F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 | 742 | 1003 | 3.0E-16 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 769 | 1043 | 3.0E-16 |
sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 730 | 1024 | 3.0E-16 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 789 | 1081 | 3.0E-16 |
sp|O35142|COPB2_RAT | Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 | 761 | 1022 | 3.0E-16 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 749 | 1018 | 3.0E-16 |
sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 729 | 1024 | 3.0E-16 |
sp|Q6FLI3|CAF4_CANGA | CCR4-associated factor 4 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAF4 PE=3 SV=1 | 762 | 1042 | 3.0E-16 |
sp|Q5SUS0|FBW10_MOUSE | F-box/WD repeat-containing protein 10 OS=Mus musculus GN=Fbxw10 PE=2 SV=1 | 886 | 1064 | 3.0E-16 |
sp|Q21215|GBLP_CAEEL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 | 829 | 1047 | 3.0E-16 |
sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 728 | 1024 | 3.0E-16 |
sp|Q4R8H1|TBL1X_MACFA | F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 | 742 | 1003 | 3.0E-16 |
sp|Q5SRY7|FBW1B_MOUSE | F-box/WD repeat-containing protein 11 OS=Mus musculus GN=Fbxw11 PE=1 SV=1 | 894 | 1116 | 4.0E-16 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 930 | 1065 | 4.0E-16 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 930 | 1065 | 4.0E-16 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 930 | 1065 | 4.0E-16 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 930 | 1065 | 4.0E-16 |
sp|Q758R7|MDV1_ASHGO | Mitochondrial division protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MDV1 PE=3 SV=1 | 818 | 1075 | 4.0E-16 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 852 | 1072 | 4.0E-16 |
sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 733 | 1005 | 4.0E-16 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 752 | 1002 | 4.0E-16 |
sp|A4R3M4|LIS1_MAGO7 | Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 | 739 | 1024 | 4.0E-16 |
sp|B2AEZ5|LIS11_PODAN | Nuclear distribution protein PAC1-1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-1 PE=3 SV=2 | 792 | 1052 | 4.0E-16 |
sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 771 | 1081 | 4.0E-16 |
sp|O42249|GBLP_ORENI | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 | 845 | 1047 | 4.0E-16 |
sp|Q4V7A0|WDR61_RAT | WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 | 771 | 1081 | 4.0E-16 |
sp|Q9AUR7|COPA2_ORYSJ | Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 | 752 | 1008 | 4.0E-16 |
sp|Q3ULA2|FBW1A_MOUSE | F-box/WD repeat-containing protein 1A OS=Mus musculus GN=Btrc PE=1 SV=2 | 895 | 1116 | 5.0E-16 |
sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 901 | 1044 | 5.0E-16 |
sp|Q4P8R5|MDV1_USTMA | Mitochondrial division protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDV1 PE=3 SV=1 | 742 | 1041 | 5.0E-16 |
sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 729 | 1013 | 5.0E-16 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 846 | 1052 | 5.0E-16 |
sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 842 | 1044 | 5.0E-16 |
sp|Q6FJZ9|PRP46_CANGA | Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 | 729 | 1068 | 5.0E-16 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 835 | 1053 | 6.0E-16 |
sp|Q8MY12|MHCKC_DICDI | Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 | 744 | 1041 | 6.0E-16 |
sp|P63245|GBLP_RAT | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 | 845 | 1047 | 6.0E-16 |
sp|P63246|GBLP_PIG | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 | 845 | 1047 | 6.0E-16 |
sp|P68040|GBLP_MOUSE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 | 845 | 1047 | 6.0E-16 |
sp|Q4R7Y4|GBLP_MACFA | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 | 845 | 1047 | 6.0E-16 |
sp|P63244|GBLP_HUMAN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 | 845 | 1047 | 6.0E-16 |
sp|P63247|GBLP_CHICK | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 | 845 | 1047 | 6.0E-16 |
sp|P63243|GBLP_BOVIN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 | 845 | 1047 | 6.0E-16 |
sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 737 | 976 | 6.0E-16 |
sp|Q54R82|MKKA_DICDI | Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 | 748 | 1002 | 7.0E-16 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 724 | 1043 | 7.0E-16 |
sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 897 | 1067 | 7.0E-16 |
sp|Q8RXA7|SCD1_ARATH | DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 | 775 | 1052 | 7.0E-16 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 726 | 1002 | 7.0E-16 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 890 | 1074 | 8.0E-16 |
sp|A2R3Z3|MDV1_ASPNC | Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2 | 683 | 1007 | 8.0E-16 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 723 | 1006 | 8.0E-16 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 752 | 1002 | 8.0E-16 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 733 | 1002 | 9.0E-16 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 891 | 1052 | 9.0E-16 |
sp|Q54YD8|COPB2_DICDI | Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 | 699 | 996 | 9.0E-16 |
sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 737 | 1003 | 9.0E-16 |
sp|Q9AUR8|COPA1_ORYSJ | Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 | 752 | 1008 | 9.0E-16 |
sp|Q91854|TRCB_XENLA | Beta-TrCP OS=Xenopus laevis GN=fbxw1 PE=2 SV=1 | 895 | 1116 | 1.0E-15 |
sp|A8PTE4|MDV1_MALGO | Mitochondrial division protein 1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MDV1 PE=3 SV=1 | 868 | 1013 | 1.0E-15 |
sp|A1CBP8|MDV1_ASPCL | Mitochondrial division protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdv1 PE=3 SV=1 | 741 | 1003 | 1.0E-15 |
sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 849 | 1056 | 1.0E-15 |
sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 849 | 1056 | 1.0E-15 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 891 | 1052 | 1.0E-15 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 891 | 1052 | 1.0E-15 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 752 | 1002 | 1.0E-15 |
sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 788 | 1020 | 1.0E-15 |
sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 748 | 964 | 1.0E-15 |
sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 737 | 987 | 1.0E-15 |
sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 737 | 987 | 1.0E-15 |
sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 737 | 987 | 1.0E-15 |
sp|Q12770|SCAP_HUMAN | Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens GN=SCAP PE=1 SV=4 | 779 | 1050 | 1.0E-15 |
sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 737 | 987 | 1.0E-15 |
sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 742 | 1003 | 2.0E-15 |
sp|Q6GM65|PLAP_XENLA | Phospholipase A-2-activating protein OS=Xenopus laevis GN=plaa PE=2 SV=2 | 752 | 1002 | 2.0E-15 |
sp|Q4WT34|PRP46_ASPFU | Pre-mRNA-splicing factor prp46 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp46 PE=3 SV=1 | 876 | 1059 | 2.0E-15 |
sp|Q5BE22|PRP46_EMENI | Pre-mRNA-splicing factor prp46 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp46 PE=3 SV=1 | 877 | 1059 | 2.0E-15 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 891 | 1052 | 2.0E-15 |
sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 844 | 1052 | 2.0E-15 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 752 | 1002 | 2.0E-15 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 813 | 1069 | 2.0E-15 |
sp|A4RJV3|MDV1_MAGO7 | Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 | 742 | 1008 | 2.0E-15 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 775 | 1006 | 2.0E-15 |
sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 640 | 1024 | 2.0E-15 |
sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 775 | 1050 | 2.0E-15 |
sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 775 | 1050 | 2.0E-15 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 752 | 1021 | 2.0E-15 |
sp|Q6NNP0|ATG16_ARATH | Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1 | 868 | 1058 | 2.0E-15 |
sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 789 | 1002 | 2.0E-15 |
sp|Q94A40|COPA1_ARATH | Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 | 752 | 1008 | 2.0E-15 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 767 | 1009 | 2.0E-15 |
sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 737 | 976 | 2.0E-15 |
sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 729 | 1024 | 2.0E-15 |
sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 772 | 1048 | 2.0E-15 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 769 | 1009 | 2.0E-15 |
sp|O88466|ZN106_MOUSE | Zinc finger protein 106 OS=Mus musculus GN=Znf106 PE=1 SV=3 | 775 | 1023 | 2.0E-15 |
sp|Q5A7Q3|PRP46_CANAL | Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 | 770 | 964 | 2.0E-15 |
sp|O42248|GBLP_DANRE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 | 845 | 1047 | 2.0E-15 |
sp|P07834|CDC4_YEAST | Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC4 PE=1 SV=2 | 469 | 971 | 3.0E-15 |
sp|Q9UKB1|FBW1B_HUMAN | F-box/WD repeat-containing protein 11 OS=Homo sapiens GN=FBXW11 PE=1 SV=1 | 894 | 1116 | 3.0E-15 |
sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 742 | 1003 | 3.0E-15 |
sp|O95170|CDRT1_HUMAN | CMT1A duplicated region transcript 1 protein OS=Homo sapiens GN=CDRT1 PE=2 SV=3 | 864 | 1040 | 3.0E-15 |
sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 775 | 1050 | 3.0E-15 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 752 | 1049 | 3.0E-15 |
sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 737 | 976 | 3.0E-15 |
sp|O45040|GBB1_HOMAM | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 | 725 | 963 | 3.0E-15 |
sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 769 | 1081 | 3.0E-15 |
sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 737 | 987 | 3.0E-15 |
sp|P49027|GBLPA_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 | 846 | 1047 | 3.0E-15 |
sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 729 | 1024 | 4.0E-15 |
sp|P63245|GBLP_RAT | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 | 750 | 1005 | 4.0E-15 |
sp|P63246|GBLP_PIG | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 | 750 | 1005 | 4.0E-15 |
sp|P68040|GBLP_MOUSE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 | 750 | 1005 | 4.0E-15 |
sp|Q4R7Y4|GBLP_MACFA | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 | 750 | 1005 | 4.0E-15 |
sp|P63244|GBLP_HUMAN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 | 750 | 1005 | 4.0E-15 |
sp|P63247|GBLP_CHICK | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 | 750 | 1005 | 4.0E-15 |
sp|P63243|GBLP_BOVIN | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 | 750 | 1005 | 4.0E-15 |
sp|Q96WV5|COPA_SCHPO | Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 | 752 | 1113 | 4.0E-15 |
sp|B0X2V9|WDR48_CULQU | WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1 | 843 | 1060 | 4.0E-15 |
sp|Q5GIS3|GBB_PINFU | Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 | 725 | 963 | 4.0E-15 |
sp|Q9HAV0|GBB4_HUMAN | Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 | 725 | 963 | 4.0E-15 |
sp|Q25189|GBLP_HYDVU | Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 | 750 | 1005 | 4.0E-15 |
sp|Q9C827|COB22_ARATH | Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 | 792 | 1038 | 4.0E-15 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 742 | 964 | 5.0E-15 |
sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 881 | 1043 | 5.0E-15 |
sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 891 | 1043 | 5.0E-15 |
sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 770 | 1050 | 5.0E-15 |
sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 890 | 1048 | 5.0E-15 |
sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 775 | 1050 | 5.0E-15 |
sp|P49027|GBLPA_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 | 773 | 1006 | 5.0E-15 |
sp|Q0J3D9|COPA3_ORYSJ | Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 | 752 | 1008 | 5.0E-15 |
sp|Q5MNU5|SCAP_PIG | Sterol regulatory element-binding protein cleavage-activating protein OS=Sus scrofa GN=SCAP PE=2 SV=2 | 779 | 1050 | 5.0E-15 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 727 | 1008 | 6.0E-15 |
sp|Q9BQ87|TBL1Y_HUMAN | F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 | 907 | 1067 | 6.0E-15 |
sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 890 | 1048 | 6.0E-15 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 893 | 1052 | 6.0E-15 |
sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 845 | 1047 | 6.0E-15 |
sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 725 | 963 | 6.0E-15 |
sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 725 | 963 | 6.0E-15 |
sp|P79959|GBB1_XENLA | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 | 725 | 963 | 6.0E-15 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 748 | 963 | 7.0E-15 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 850 | 1085 | 7.0E-15 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 815 | 1085 | 8.0E-15 |
sp|P93340|GBLP_NICPL | Guanine nucleotide-binding protein subunit beta-like protein OS=Nicotiana plumbaginifolia PE=2 SV=1 | 849 | 1052 | 8.0E-15 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 891 | 1052 | 8.0E-15 |
sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 750 | 1043 | 8.0E-15 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 748 | 963 | 9.0E-15 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 740 | 938 | 9.0E-15 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 891 | 1016 | 9.0E-15 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 891 | 1052 | 9.0E-15 |
sp|O42248|GBLP_DANRE | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 | 727 | 1005 | 9.0E-15 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 721 | 980 | 9.0E-15 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 721 | 980 | 9.0E-15 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 748 | 963 | 1.0E-14 |
sp|Q2H139|MDV1_CHAGB | Mitochondrial division protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDV1 PE=3 SV=2 | 742 | 1008 | 1.0E-14 |
sp|Q8BHD1|POC1B_MOUSE | POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 | 771 | 1064 | 1.0E-14 |
sp|Q9QXE7|TBL1X_MOUSE | F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 | 775 | 1067 | 1.0E-14 |
sp|P35606|COPB2_HUMAN | Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 | 847 | 1074 | 1.0E-14 |
sp|O55029|COPB2_MOUSE | Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 | 847 | 1074 | 1.0E-14 |
sp|P35605|COPB2_BOVIN | Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 | 847 | 1074 | 1.0E-14 |
sp|Q5R664|COPB2_PONAB | Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 | 847 | 1074 | 1.0E-14 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 747 | 1064 | 1.0E-14 |
sp|Q5SUS0|FBW10_MOUSE | F-box/WD repeat-containing protein 10 OS=Mus musculus GN=Fbxw10 PE=2 SV=1 | 785 | 1080 | 1.0E-14 |
sp|O42249|GBLP_ORENI | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 | 750 | 1005 | 1.0E-14 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 771 | 1064 | 1.0E-14 |
sp|Q7PS24|CIAO1_ANOGA | Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 | 770 | 1001 | 1.0E-14 |
sp|Q58D00|FBXW2_BOVIN | F-box/WD repeat-containing protein 2 OS=Bos taurus GN=FBXW2 PE=2 SV=1 | 849 | 1067 | 1.0E-14 |
sp|Q32LN7|WDR61_BOVIN | WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 | 748 | 1042 | 1.0E-14 |
sp|Q32LN7|WDR61_BOVIN | WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1 | 771 | 1081 | 1.0E-14 |
sp|Q9UKT8|FBXW2_HUMAN | F-box/WD repeat-containing protein 2 OS=Homo sapiens GN=FBXW2 PE=1 SV=2 | 849 | 1067 | 1.0E-14 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 748 | 963 | 2.0E-14 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 775 | 1052 | 2.0E-14 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 891 | 1052 | 2.0E-14 |
sp|Q09715|TUP11_SCHPO | Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 | 900 | 1066 | 2.0E-14 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 815 | 1085 | 2.0E-14 |
sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 788 | 1020 | 2.0E-14 |
sp|O13615|PRP46_SCHPO | Pre-mRNA-splicing factor prp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp5 PE=1 SV=1 | 733 | 1002 | 2.0E-14 |
sp|Q5XX13|FBW10_HUMAN | F-box/WD repeat-containing protein 10 OS=Homo sapiens GN=FBXW10 PE=2 SV=2 | 886 | 1052 | 2.0E-14 |
sp|B7FNU7|LIS1_PHATC | Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 | 811 | 1052 | 2.0E-14 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 745 | 994 | 2.0E-14 |
sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 900 | 1041 | 2.0E-14 |
sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 900 | 1041 | 2.0E-14 |
sp|Q4R4I8|COPB2_MACFA | Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 | 847 | 1062 | 2.0E-14 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 893 | 1052 | 2.0E-14 |
sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 750 | 1042 | 2.0E-14 |
sp|Q05B17|WDR48_XENTR | WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 | 843 | 1080 | 2.0E-14 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 748 | 969 | 2.0E-14 |
sp|P26308|GBB1_DROME | Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 | 725 | 963 | 2.0E-14 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 727 | 1002 | 2.0E-14 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 727 | 1072 | 2.0E-14 |
sp|Q05048|CSTF1_HUMAN | Cleavage stimulation factor subunit 1 OS=Homo sapiens GN=CSTF1 PE=1 SV=1 | 778 | 1047 | 2.0E-14 |
sp|Q54MP8|Y5837_DICDI | Bromodomain and WD repeat-containing DDB_G0285837 OS=Dictyostelium discoideum GN=DDB_G0285837 PE=3 SV=1 | 744 | 1066 | 2.0E-14 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 748 | 963 | 3.0E-14 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 748 | 963 | 3.0E-14 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 748 | 963 | 3.0E-14 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 748 | 963 | 3.0E-14 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 748 | 963 | 3.0E-14 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 740 | 938 | 3.0E-14 |
sp|P93107|PF20_CHLRE | Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 | 752 | 1041 | 3.0E-14 |
sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 739 | 1001 | 3.0E-14 |
sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 739 | 976 | 3.0E-14 |
sp|Q9GZS3|WDR61_HUMAN | WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1 | 748 | 1042 | 3.0E-14 |
sp|Q8L828|COB23_ARATH | Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 | 761 | 1040 | 3.0E-14 |
sp|Q55FR9|COPA_DICDI | Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 | 761 | 1008 | 3.0E-14 |
sp|Q9CAA0|COB21_ARATH | Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 | 792 | 1042 | 3.0E-14 |
sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 900 | 1046 | 3.0E-14 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 745 | 994 | 4.0E-14 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 891 | 1041 | 4.0E-14 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 748 | 969 | 4.0E-14 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 736 | 1041 | 4.0E-14 |
sp|Q5ZME8|SMU1_CHICK | WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 | 901 | 1048 | 4.0E-14 |
sp|Q08706|GBB_LYMST | Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 | 725 | 963 | 4.0E-14 |
sp|Q5BJQ6|CSTF1_RAT | Cleavage stimulation factor subunit 1 OS=Rattus norvegicus GN=Cstf1 PE=2 SV=1 | 778 | 1047 | 4.0E-14 |
sp|Q99LC2|CSTF1_MOUSE | Cleavage stimulation factor subunit 1 OS=Mus musculus GN=Cstf1 PE=1 SV=1 | 778 | 1047 | 4.0E-14 |
sp|Q60584|FBXW2_MOUSE | F-box/WD repeat-containing protein 2 OS=Mus musculus GN=Fbxw2 PE=2 SV=2 | 849 | 1043 | 4.0E-14 |
sp|A7TNS8|CAF4_VANPO | CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1 | 736 | 1009 | 5.0E-14 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 729 | 1064 | 5.0E-14 |
sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 884 | 1052 | 5.0E-14 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 849 | 1049 | 5.0E-14 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 890 | 1043 | 5.0E-14 |
sp|Q4V7A0|WDR61_RAT | WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 | 750 | 1042 | 5.0E-14 |
sp|A0JPH4|SCAP_XENLA | Sterol regulatory element-binding protein cleavage-activating protein OS=Xenopus laevis GN=scap PE=2 SV=1 | 776 | 1050 | 5.0E-14 |
sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 680 | 1005 | 5.0E-14 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 748 | 963 | 6.0E-14 |
sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 743 | 962 | 6.0E-14 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 792 | 1052 | 6.0E-14 |
sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 792 | 1043 | 6.0E-14 |
sp|Q5AXW3|MDV1_EMENI | Mitochondrial division protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mdv1 PE=3 SV=2 | 925 | 1052 | 6.0E-14 |
sp|Q4R8H1|TBL1X_MACFA | F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 | 775 | 1067 | 6.0E-14 |
sp|O14435|GBB_CRYPA | Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 | 734 | 962 | 6.0E-14 |
sp|Q0DYP5|C3H17_ORYSJ | Zinc finger CCCH domain-containing protein 17 OS=Oryza sativa subsp. japonica GN=Os02g0677700 PE=2 SV=2 | 775 | 1002 | 6.0E-14 |
sp|P97260|SCAP_CRIGR | Sterol regulatory element-binding protein cleavage-activating protein OS=Cricetulus griseus GN=SCAP PE=1 SV=1 | 780 | 1050 | 6.0E-14 |
sp|P53622|COPA_YEAST | Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 | 761 | 964 | 6.0E-14 |
sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 739 | 956 | 7.0E-14 |
sp|Q21215|GBLP_CAEEL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 | 740 | 1005 | 7.0E-14 |
sp|Q6GQT6|SCAP_MOUSE | Sterol regulatory element-binding protein cleavage-activating protein OS=Mus musculus GN=Scap PE=1 SV=1 | 780 | 1050 | 7.0E-14 |
sp|B2RZ17|FBXW2_RAT | F-box/WD repeat-containing protein 2 OS=Rattus norvegicus GN=Fbxw2 PE=2 SV=1 | 849 | 1043 | 7.0E-14 |
sp|Q8IZU2|WDR17_HUMAN | WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 | 748 | 1002 | 7.0E-14 |
sp|C1GB49|LIS1_PARBD | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 | 890 | 1064 | 8.0E-14 |
sp|C0S902|LIS1_PARBP | Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 | 890 | 1064 | 8.0E-14 |
sp|A2CEH0|POC1B_DANRE | POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 | 734 | 1021 | 8.0E-14 |
sp|Q99M63|SMU1_RAT | WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 | 901 | 1048 | 8.0E-14 |
sp|Q3UKJ7|SMU1_MOUSE | WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 | 901 | 1048 | 8.0E-14 |
sp|Q2TAY7|SMU1_HUMAN | WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 | 901 | 1048 | 8.0E-14 |
sp|Q76B40|SMU1_CRIGR | WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 | 901 | 1048 | 8.0E-14 |
sp|Q2TBS9|SMU1_BOVIN | WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 | 901 | 1048 | 8.0E-14 |
sp|A8Q2R5|WDR48_BRUMA | WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 | 739 | 996 | 8.0E-14 |
sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 778 | 1046 | 9.0E-14 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 930 | 1050 | 9.0E-14 |
sp|Q4R2Z6|WDR48_MACFA | WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 | 843 | 1080 | 9.0E-14 |
sp|P54311|GBB1_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 | 725 | 963 | 9.0E-14 |
sp|P62874|GBB1_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 | 725 | 963 | 9.0E-14 |
sp|P62873|GBB1_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 | 725 | 963 | 9.0E-14 |
sp|P62872|GBB1_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 | 725 | 963 | 9.0E-14 |
sp|P62871|GBB1_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 | 725 | 963 | 9.0E-14 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 862 | 1047 | 1.0E-13 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 748 | 963 | 1.0E-13 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 930 | 1065 | 1.0E-13 |
sp|Q6CB13|MDV1_YARLI | Mitochondrial division protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDV1 PE=3 SV=1 | 925 | 1052 | 1.0E-13 |
sp|O95170|CDRT1_HUMAN | CMT1A duplicated region transcript 1 protein OS=Homo sapiens GN=CDRT1 PE=2 SV=3 | 886 | 1052 | 1.0E-13 |
sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 872 | 1043 | 1.0E-13 |
sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 872 | 1043 | 1.0E-13 |
sp|O62621|COPB2_DROME | Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 | 818 | 1062 | 1.0E-13 |
sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 739 | 1001 | 1.0E-13 |
sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 739 | 1001 | 1.0E-13 |
sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 739 | 976 | 1.0E-13 |
sp|O60907|TBL1X_HUMAN | F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 | 775 | 1067 | 1.0E-13 |
sp|O35142|COPB2_RAT | Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 | 847 | 1074 | 1.0E-13 |
sp|Q8TAF3|WDR48_HUMAN | WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 | 843 | 1080 | 1.0E-13 |
sp|Q32PG3|WDR48_BOVIN | WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 | 843 | 1080 | 1.0E-13 |
sp|Q5RAW8|WDR48_PONAB | WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 | 843 | 1080 | 1.0E-13 |
sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 843 | 1065 | 1.0E-13 |
sp|Q8BH57|WDR48_MOUSE | WD repeat-containing protein 48 OS=Mus musculus GN=Wdr48 PE=1 SV=1 | 843 | 1080 | 1.0E-13 |
sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 752 | 1024 | 1.0E-13 |
sp|Q5R8K2|CSTF1_PONAB | Cleavage stimulation factor subunit 1 OS=Pongo abelii GN=CSTF1 PE=2 SV=1 | 778 | 1047 | 1.0E-13 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 752 | 982 | 1.0E-13 |
sp|O94394|YQF1_SCHPO | Uncharacterized WD repeat-containing protein C126.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC126.01c PE=3 SV=2 | 763 | 1043 | 1.0E-13 |
sp|Q6NRT3|SMU1_XENLA | WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 | 901 | 1048 | 1.0E-13 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 748 | 1055 | 1.0E-13 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 891 | 1041 | 1.0E-13 |
sp|P23232|GBB_LOLFO | Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 | 725 | 963 | 1.0E-13 |
sp|Q6TMK6|GBB1_CRIGR | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 | 725 | 963 | 1.0E-13 |
sp|Q5R5W8|GBB1_PONAB | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 | 725 | 963 | 1.0E-13 |
sp|Q00659|SCONB_EMENI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sconB PE=3 SV=2 | 967 | 1065 | 2.0E-13 |
sp|Q2H139|MDV1_CHAGB | Mitochondrial division protein 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MDV1 PE=3 SV=2 | 775 | 1002 | 2.0E-13 |
sp|O76734|TUP1_DICDI | General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 | 901 | 1072 | 2.0E-13 |
sp|Q9P7I3|MDV1_SCHPO | Mitochondrial division protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdv1 PE=3 SV=1 | 718 | 1033 | 2.0E-13 |
sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 879 | 1081 | 2.0E-13 |
sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 891 | 1043 | 2.0E-13 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 891 | 1043 | 2.0E-13 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 843 | 1085 | 2.0E-13 |
sp|B4KRQ4|WDR48_DROMO | WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 | 739 | 976 | 2.0E-13 |
sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 739 | 976 | 2.0E-13 |
sp|Q8MY12|MHCKC_DICDI | Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 | 850 | 1052 | 2.0E-13 |
sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 843 | 1065 | 2.0E-13 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 748 | 1055 | 2.0E-13 |
sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 850 | 1060 | 2.0E-13 |
sp|Q5XGI5|WDR83_XENTR | WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 | 745 | 1041 | 2.0E-13 |
sp|Q6FJS0|PFS2_CANGA | Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 | 887 | 1060 | 2.0E-13 |
sp|Q6P4J8|SMU1_XENTR | WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 | 901 | 1048 | 2.0E-13 |
sp|Q27954|COPA_BOVIN | Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 | 752 | 973 | 2.0E-13 |
sp|A7RHG8|WDR12_NEMVE | Ribosome biogenesis protein WDR12 homolog (Fragment) OS=Nematostella vectensis GN=v1g82024 PE=3 SV=1 | 790 | 1045 | 2.0E-13 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 891 | 1041 | 2.0E-13 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 891 | 1041 | 2.0E-13 |
sp|P53621|COPA_HUMAN | Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 | 752 | 973 | 2.0E-13 |
sp|A6QM06|SCAP_BOVIN | Sterol regulatory element-binding protein cleavage-activating protein OS=Bos taurus GN=SCAP PE=2 SV=1 | 779 | 1050 | 2.0E-13 |
sp|P87060|POP1_SCHPO | WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop1 PE=1 SV=1 | 476 | 576 | 3.0E-13 |
sp|B6GZA1|SCONB_PENRW | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sconB PE=3 SV=1 | 927 | 1065 | 3.0E-13 |
sp|Q7S8R5|MDV1_NEUCR | Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 | 775 | 1008 | 3.0E-13 |
sp|Q01277|SCONB_NEUCR | Probable E3 ubiquitin ligase complex SCF subunit scon-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=scon-2 PE=1 SV=1 | 970 | 1088 | 3.0E-13 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 734 | 1002 | 3.0E-13 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 752 | 1020 | 3.0E-13 |
sp|B4J8H6|WDR48_DROGR | WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 | 739 | 976 | 3.0E-13 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 891 | 1045 | 3.0E-13 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 891 | 1045 | 3.0E-13 |
sp|Q27954|COPA_BOVIN | Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 | 752 | 1060 | 3.0E-13 |
sp|P53621|COPA_HUMAN | Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 | 752 | 1060 | 3.0E-13 |
sp|Q8CIE6|COPA_MOUSE | Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 | 752 | 973 | 3.0E-13 |
sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 737 | 1077 | 3.0E-13 |
sp|A2RRU4|SCAP_RAT | Sterol regulatory element-binding protein cleavage-activating protein OS=Rattus norvegicus GN=Scap PE=2 SV=1 | 780 | 1050 | 3.0E-13 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 891 | 1052 | 4.0E-13 |
sp|P83774|GBLP_CANAL | Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 | 750 | 1045 | 4.0E-13 |
sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 891 | 1043 | 4.0E-13 |
sp|A4RJV3|MDV1_MAGO7 | Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 | 925 | 1052 | 4.0E-13 |
sp|Q28YY2|WDR48_DROPS | WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 | 739 | 1001 | 4.0E-13 |
sp|B4GIJ0|WDR48_DROPE | WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 | 739 | 1001 | 4.0E-13 |
sp|Q8CIE6|COPA_MOUSE | Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 | 752 | 1060 | 4.0E-13 |
sp|Q54SF9|MHCKD_DICDI | Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 | 842 | 1045 | 4.0E-13 |
sp|P39946|LIS1_YEAST | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAC1 PE=1 SV=2 | 791 | 1026 | 4.0E-13 |
sp|A6ZPA6|LIS1_YEAS7 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PAC1 PE=3 SV=1 | 791 | 1026 | 4.0E-13 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 891 | 1041 | 4.0E-13 |
sp|B6Q4Z5|SCONB_TALMQ | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 | 967 | 1064 | 5.0E-13 |
sp|B3LJT5|LIS1_YEAS1 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=PAC1 PE=3 SV=1 | 791 | 1026 | 5.0E-13 |
sp|B8M7Q5|SCONB_TALSN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 | 967 | 1065 | 6.0E-13 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 878 | 1081 | 6.0E-13 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 928 | 1072 | 6.0E-13 |
sp|B2B766|LIS12_PODAN | Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 | 772 | 1052 | 6.0E-13 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 700 | 1041 | 6.0E-13 |
sp|P36408|GBB_DICDI | Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 | 736 | 962 | 6.0E-13 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 743 | 863 | 7.0E-13 |
sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 889 | 1052 | 7.0E-13 |
sp|Q9UUG8|TUP12_SCHPO | Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 | 900 | 1068 | 7.0E-13 |
sp|A7RHG8|WDR12_NEMVE | Ribosome biogenesis protein WDR12 homolog (Fragment) OS=Nematostella vectensis GN=v1g82024 PE=3 SV=1 | 752 | 1033 | 7.0E-13 |
sp|Q5VQ78|COB21_ORYSJ | Coatomer subunit beta'-1 OS=Oryza sativa subsp. japonica GN=Os06g0143900 PE=2 SV=1 | 752 | 973 | 8.0E-13 |
sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 772 | 1046 | 8.0E-13 |
sp|Q6NNP0|ATG16_ARATH | Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1 | 745 | 1027 | 8.0E-13 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 840 | 1052 | 9.0E-13 |
sp|P42527|MHCKA_DICDI | Myosin heavy chain kinase A OS=Dictyostelium discoideum GN=mhkA PE=1 SV=2 | 884 | 1052 | 9.0E-13 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 700 | 1041 | 9.0E-13 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 734 | 927 | 1.0E-12 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 888 | 1052 | 1.0E-12 |
sp|Q1DIW7|MDV1_COCIM | Mitochondrial division protein 1 OS=Coccidioides immitis (strain RS) GN=MDV1 PE=3 SV=2 | 732 | 1021 | 1.0E-12 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 891 | 1052 | 1.0E-12 |
sp|Q6CJ50|MDV1_KLULA | Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1 | 874 | 1072 | 1.0E-12 |
sp|P47025|MDV1_YEAST | Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 | 775 | 1002 | 1.0E-12 |
sp|A6ZQL5|MDV1_YEAS7 | Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 | 775 | 1002 | 1.0E-12 |
sp|A7EKM8|LIS1_SCLS1 | Nuclear distribution protein PAC1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=pac1 PE=3 SV=1 | 819 | 1053 | 1.0E-12 |
sp|P83774|GBLP_CANAL | Guanine nucleotide-binding protein subunit beta-like protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASC1 PE=1 SV=2 | 891 | 1043 | 1.0E-12 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 734 | 1049 | 1.0E-12 |
sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 812 | 1085 | 1.0E-12 |
sp|Q20168|COPB2_CAEEL | Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 | 752 | 962 | 1.0E-12 |
sp|Q75BY3|PRP46_ASHGO | Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP46 PE=3 SV=2 | 748 | 1041 | 1.0E-12 |
sp|Q6H8D5|COB22_ORYSJ | Coatomer subunit beta'-2 OS=Oryza sativa subsp. japonica GN=Os02g0209100 PE=2 SV=1 | 752 | 973 | 1.0E-12 |
sp|Q8K450|SPG16_MOUSE | Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 | 744 | 1002 | 1.0E-12 |
sp|Q9C827|COB22_ARATH | Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 | 843 | 1052 | 1.0E-12 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 700 | 1041 | 1.0E-12 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 700 | 1041 | 1.0E-12 |
sp|C8ZH19|LIS1_YEAS8 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=PAC1 PE=3 SV=1 | 791 | 1026 | 1.0E-12 |
sp|Q7RY68|PFS2_NEUCR | Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 | 887 | 1044 | 1.0E-12 |
sp|Q10051|PRP19_CAEEL | Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2 | 781 | 973 | 1.0E-12 |
sp|Q6CG48|LIS1_YARLI | Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 | 792 | 1050 | 1.0E-12 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 900 | 1046 | 1.0E-12 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 891 | 1052 | 2.0E-12 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 891 | 1052 | 2.0E-12 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 891 | 1052 | 2.0E-12 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 891 | 1052 | 2.0E-12 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 891 | 1052 | 2.0E-12 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 835 | 1064 | 2.0E-12 |
sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 768 | 1050 | 2.0E-12 |
sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 768 | 1050 | 2.0E-12 |
sp|Q6H8D6|COB23_ORYSJ | Putative coatomer subunit beta'-3 OS=Oryza sativa subsp. japonica GN=Os02g0209000 PE=3 SV=2 | 752 | 973 | 2.0E-12 |
sp|C7Z6H2|LIS1_NECH7 | Nuclear distribution protein PAC1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=PAC1 PE=3 SV=1 | 756 | 975 | 2.0E-12 |
sp|Q9CAA0|COB21_ARATH | Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 | 752 | 973 | 2.0E-12 |
sp|A8Q2R5|WDR48_BRUMA | WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 | 818 | 1086 | 2.0E-12 |
sp|Q9FNZ1|C3H63_ARATH | Zinc finger CCCH domain-containing protein 63 OS=Arabidopsis thaliana GN=ZFWD2 PE=2 SV=1 | 743 | 1007 | 2.0E-12 |
sp|Q54Y96|SMU1_DICDI | WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 | 792 | 973 | 2.0E-12 |
sp|Q5BLX8|WDR83_RAT | WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 | 887 | 1047 | 2.0E-12 |
sp|Q9DAJ4|WDR83_MOUSE | WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 | 887 | 1047 | 2.0E-12 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 801 | 1003 | 2.0E-12 |
sp|O15736|TIPD_DICDI | Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1 | 893 | 1096 | 2.0E-12 |
sp|O35353|GBB4_RAT | Guanine nucleotide-binding protein subunit beta-4 OS=Rattus norvegicus GN=Gnb4 PE=2 SV=4 | 725 | 963 | 2.0E-12 |
sp|A1DHW6|SCONB_NEOFI | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sconB PE=3 SV=1 | 967 | 1066 | 3.0E-12 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 928 | 1047 | 3.0E-12 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 967 | 1065 | 3.0E-12 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 967 | 1065 | 3.0E-12 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 748 | 962 | 3.0E-12 |
sp|A1CBP8|MDV1_ASPCL | Mitochondrial division protein 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mdv1 PE=3 SV=1 | 922 | 1052 | 3.0E-12 |
sp|Q6Q0C0|TRAF7_HUMAN | E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 | 811 | 1060 | 3.0E-12 |
sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 792 | 1043 | 3.0E-12 |
sp|Q6CKE8|PRP46_KLULA | Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 | 770 | 1054 | 3.0E-12 |
sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 744 | 1004 | 3.0E-12 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 749 | 973 | 3.0E-12 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 749 | 1020 | 3.0E-12 |
sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 773 | 1052 | 3.0E-12 |
sp|Q9C827|COB22_ARATH | Coatomer subunit beta'-2 OS=Arabidopsis thaliana GN=At1g52360 PE=2 SV=1 | 752 | 973 | 3.0E-12 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 801 | 1003 | 3.0E-12 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 850 | 1096 | 3.0E-12 |
sp|Q54N86|FBXAL_DICDI | F-box/WD repeat-containing protein A-like protein OS=Dictyostelium discoideum GN=DDB_G0285445 PE=3 SV=1 | 774 | 1083 | 3.0E-12 |
sp|P29387|GBB4_MOUSE | Guanine nucleotide-binding protein subunit beta-4 OS=Mus musculus GN=Gnb4 PE=1 SV=4 | 725 | 963 | 3.0E-12 |
sp|O13982|YEC8_SCHPO | Uncharacterized WD repeat-containing protein C25H1.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25H1.08c PE=3 SV=1 | 747 | 1037 | 3.0E-12 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 891 | 1052 | 4.0E-12 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 891 | 1052 | 4.0E-12 |
sp|Q42384|PRL1_ARATH | Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 | 889 | 1052 | 4.0E-12 |
sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 832 | 1053 | 4.0E-12 |
sp|P35606|COPB2_HUMAN | Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 | 752 | 966 | 4.0E-12 |
sp|O55029|COPB2_MOUSE | Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 | 752 | 966 | 4.0E-12 |
sp|P35605|COPB2_BOVIN | Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 | 752 | 966 | 4.0E-12 |
sp|Q5R664|COPB2_PONAB | Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 | 752 | 966 | 4.0E-12 |
sp|Q4R4I8|COPB2_MACFA | Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 | 752 | 966 | 4.0E-12 |
sp|Q6FLI3|CAF4_CANGA | CCR4-associated factor 4 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAF4 PE=3 SV=1 | 890 | 1054 | 4.0E-12 |
sp|Q8L828|COB23_ARATH | Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 | 752 | 973 | 4.0E-12 |
sp|Q54Y96|SMU1_DICDI | WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 | 908 | 1052 | 4.0E-12 |
sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 735 | 962 | 4.0E-12 |
sp|Q6FWT9|LIS1_CANGA | Nuclear distribution protein PAC1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAC1 PE=3 SV=1 | 816 | 1031 | 4.0E-12 |
sp|Q05583|CIAO1_YEAST | Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIA1 PE=1 SV=1 | 771 | 1002 | 4.0E-12 |
sp|A2R3Z3|MDV1_ASPNC | Mitochondrial division protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mdv1 PE=3 SV=2 | 925 | 1052 | 5.0E-12 |
sp|Q6BU94|PRP46_DEBHA | Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 | 765 | 1031 | 5.0E-12 |
sp|Q0CY32|SCONB_ASPTN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sconB PE=3 SV=1 | 973 | 1066 | 6.0E-12 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 891 | 1052 | 6.0E-12 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 891 | 1052 | 6.0E-12 |
sp|Q922B6|TRAF7_MOUSE | E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 | 811 | 1060 | 6.0E-12 |
sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 729 | 975 | 6.0E-12 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 891 | 1053 | 6.0E-12 |
sp|Q80ZD0|GBB5_TAMST | Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 | 735 | 962 | 6.0E-12 |
sp|P61480|WDR12_RAT | Ribosome biogenesis protein WDR12 OS=Rattus norvegicus GN=Wdr12 PE=2 SV=1 | 792 | 1045 | 6.0E-12 |
sp|Q5RDY7|GBB5_PONAB | Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 | 735 | 962 | 6.0E-12 |
sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 735 | 962 | 6.0E-12 |
sp|Q55AR8|SNR40_DICDI | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 | 775 | 1044 | 6.0E-12 |
sp|Q4X0A9|SCONB_ASPFU | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sconB PE=3 SV=1 | 973 | 1065 | 7.0E-12 |
sp|B0XTS1|SCONB_ASPFC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sconB PE=3 SV=1 | 973 | 1065 | 7.0E-12 |
sp|A1C7E4|SCONB_ASPCL | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sconB PE=3 SV=1 | 967 | 1065 | 7.0E-12 |
sp|Q20168|COPB2_CAEEL | Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 | 908 | 1052 | 7.0E-12 |
sp|Q6CKE8|PRP46_KLULA | Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 | 871 | 1047 | 7.0E-12 |
sp|Q54D08|LST8_DICDI | Protein LST8 homolog OS=Dictyostelium discoideum GN=lst8 PE=1 SV=1 | 732 | 987 | 7.0E-12 |
sp|Q6FJ73|CIAO1_CANGA | Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CIA1 PE=3 SV=1 | 770 | 1002 | 7.0E-12 |
sp|Q7ZVA0|SMU1_DANRE | WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 | 901 | 1048 | 7.0E-12 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 743 | 863 | 8.0E-12 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 930 | 1053 | 8.0E-12 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 737 | 962 | 8.0E-12 |
sp|Q6PNB6|GBB5_RABIT | Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 | 735 | 962 | 8.0E-12 |
sp|Q12220|UTP12_YEAST | U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 | 901 | 1043 | 8.0E-12 |
sp|C5FP68|SCONB_ARTOC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=sconB PE=3 SV=1 | 967 | 1065 | 9.0E-12 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 891 | 1052 | 9.0E-12 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 933 | 1052 | 9.0E-12 |
sp|B8NGT5|SCONB_ASPFN | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sconB PE=3 SV=1 | 973 | 1066 | 1.0E-11 |
sp|Q2UFN8|SCONB_ASPOR | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sconB PE=3 SV=1 | 973 | 1066 | 1.0E-11 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 928 | 1065 | 1.0E-11 |
sp|A6ZZZ8|CAF4_YEAS7 | CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain YJM789) GN=CAF4 PE=3 SV=2 | 729 | 1002 | 1.0E-11 |
sp|P36130|CAF4_YEAST | CCR4-associated factor 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAF4 PE=1 SV=3 | 729 | 1002 | 1.0E-11 |
sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 831 | 1046 | 1.0E-11 |
sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 831 | 1046 | 1.0E-11 |
sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 850 | 1085 | 1.0E-11 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 748 | 1002 | 1.0E-11 |
sp|Q8RXA7|SCD1_ARATH | DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 | 742 | 963 | 1.0E-11 |
sp|Q5A7Q3|PRP46_CANAL | Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 | 753 | 1002 | 1.0E-11 |
sp|Q54Y96|SMU1_DICDI | WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 | 843 | 1013 | 1.0E-11 |
sp|O14775|GBB5_HUMAN | Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 | 735 | 962 | 1.0E-11 |
sp|Q9DCE5|PK1IP_MOUSE | p21-activated protein kinase-interacting protein 1 OS=Mus musculus GN=Pak1ip1 PE=1 SV=2 | 742 | 1023 | 1.0E-11 |
sp|C7GWC1|LIS1_YEAS2 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain JAY291) GN=PAC1 PE=3 SV=1 | 791 | 1026 | 1.0E-11 |
sp|Q9JJA4|WDR12_MOUSE | Ribosome biogenesis protein WDR12 OS=Mus musculus GN=Wdr12 PE=1 SV=1 | 783 | 1045 | 1.0E-11 |
sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 845 | 1044 | 1.0E-11 |
sp|A1DDL6|MDV1_NEOFI | Mitochondrial division protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdv1 PE=3 SV=1 | 742 | 967 | 2.0E-11 |
sp|O62621|COPB2_DROME | Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 | 752 | 971 | 2.0E-11 |
sp|Q8N0X2|SPG16_HUMAN | Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 | 744 | 962 | 2.0E-11 |
sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 750 | 1005 | 2.0E-11 |
sp|O35142|COPB2_RAT | Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 | 752 | 966 | 2.0E-11 |
sp|B0X2V9|WDR48_CULQU | WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1 | 739 | 999 | 2.0E-11 |
sp|Q25189|GBLP_HYDVU | Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 | 845 | 1059 | 2.0E-11 |
sp|Q58D00|FBXW2_BOVIN | F-box/WD repeat-containing protein 2 OS=Bos taurus GN=FBXW2 PE=2 SV=1 | 891 | 1021 | 2.0E-11 |
sp|Q9UKT8|FBXW2_HUMAN | F-box/WD repeat-containing protein 2 OS=Homo sapiens GN=FBXW2 PE=1 SV=2 | 891 | 1021 | 2.0E-11 |
sp|Q9CAA0|COB21_ARATH | Coatomer subunit beta'-1 OS=Arabidopsis thaliana GN=At1g79990 PE=2 SV=2 | 843 | 1052 | 2.0E-11 |
sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 777 | 1096 | 2.0E-11 |
sp|P36408|GBB_DICDI | Guanine nucleotide-binding protein subunit beta OS=Dictyostelium discoideum GN=gpbA PE=1 SV=1 | 770 | 1052 | 2.0E-11 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 777 | 1096 | 2.0E-11 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 967 | 1066 | 3.0E-11 |
sp|A7ETB3|MDV1_SCLS1 | Mitochondrial division protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdv1 PE=3 SV=1 | 925 | 1052 | 3.0E-11 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 701 | 928 | 3.0E-11 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 885 | 1077 | 3.0E-11 |
sp|P35606|COPB2_HUMAN | Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 | 898 | 1052 | 3.0E-11 |
sp|O55029|COPB2_MOUSE | Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 | 898 | 1052 | 3.0E-11 |
sp|P35605|COPB2_BOVIN | Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 | 898 | 1052 | 3.0E-11 |
sp|Q5R664|COPB2_PONAB | Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 | 898 | 1052 | 3.0E-11 |
sp|Q4R4I8|COPB2_MACFA | Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 | 898 | 1052 | 3.0E-11 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 912 | 1050 | 3.0E-11 |
sp|Q6NNP0|ATG16_ARATH | Autophagy-related protein 16 OS=Arabidopsis thaliana GN=ATG16 PE=2 SV=1 | 773 | 1052 | 3.0E-11 |
sp|O88466|ZN106_MOUSE | Zinc finger protein 106 OS=Mus musculus GN=Znf106 PE=1 SV=3 | 726 | 1000 | 3.0E-11 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 832 | 1077 | 3.0E-11 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 832 | 1077 | 3.0E-11 |
sp|Q54Y96|SMU1_DICDI | WD40 repeat-containing protein smu1 OS=Dictyostelium discoideum GN=smu1 PE=3 SV=2 | 748 | 1051 | 3.0E-11 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 908 | 1091 | 4.0E-11 |
sp|Q9P7I3|MDV1_SCHPO | Mitochondrial division protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdv1 PE=3 SV=1 | 924 | 1052 | 4.0E-11 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 887 | 1049 | 4.0E-11 |
sp|Q5SUS0|FBW10_MOUSE | F-box/WD repeat-containing protein 10 OS=Mus musculus GN=Fbxw10 PE=2 SV=1 | 697 | 974 | 4.0E-11 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 888 | 1051 | 4.0E-11 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 900 | 1042 | 4.0E-11 |
sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 770 | 1054 | 5.0E-11 |
sp|Q2U5Z8|MDV1_ASPOR | Mitochondrial division protein 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mdv1 PE=3 SV=2 | 922 | 1052 | 5.0E-11 |
sp|O35142|COPB2_RAT | Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 | 898 | 1050 | 5.0E-11 |
sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 477 | 578 | 6.0E-11 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 885 | 1081 | 6.0E-11 |
sp|P47025|MDV1_YEAST | Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 | 905 | 1065 | 6.0E-11 |
sp|P35606|COPB2_HUMAN | Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 | 717 | 862 | 6.0E-11 |
sp|O55029|COPB2_MOUSE | Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 | 717 | 862 | 6.0E-11 |
sp|Q5R664|COPB2_PONAB | Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 | 717 | 862 | 6.0E-11 |
sp|Q60584|FBXW2_MOUSE | F-box/WD repeat-containing protein 2 OS=Mus musculus GN=Fbxw2 PE=2 SV=2 | 891 | 1021 | 6.0E-11 |
sp|P53622|COPA_YEAST | Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 | 825 | 1012 | 6.0E-11 |
sp|Q7ZVA0|SMU1_DANRE | WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 | 810 | 1013 | 6.0E-11 |
sp|P56094|TUP1_KLULA | General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 | 840 | 1052 | 7.0E-11 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 885 | 1081 | 7.0E-11 |
sp|P35605|COPB2_BOVIN | Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 | 717 | 862 | 7.0E-11 |
sp|Q4R4I8|COPB2_MACFA | Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 | 717 | 862 | 7.0E-11 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 850 | 1048 | 7.0E-11 |
sp|Q99M63|SMU1_RAT | WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 | 788 | 974 | 7.0E-11 |
sp|Q3UKJ7|SMU1_MOUSE | WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 | 788 | 974 | 7.0E-11 |
sp|Q2TAY7|SMU1_HUMAN | WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 | 788 | 974 | 7.0E-11 |
sp|Q76B40|SMU1_CRIGR | WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 | 788 | 974 | 7.0E-11 |
sp|Q2TBS9|SMU1_BOVIN | WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 | 788 | 974 | 7.0E-11 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 888 | 1043 | 7.0E-11 |
sp|C4YFX2|TUP1_CANAW | Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 | 872 | 1052 | 8.0E-11 |
sp|P0CY34|TUP1_CANAL | Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 | 872 | 1052 | 8.0E-11 |
sp|Q54R82|MKKA_DICDI | Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 | 775 | 1043 | 8.0E-11 |
sp|Q54SF9|MHCKD_DICDI | Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 | 891 | 1049 | 8.0E-11 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 736 | 921 | 1.0E-10 |
sp|A0DB19|LIS11_PARTE | Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 | 931 | 1089 | 1.0E-10 |
sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 931 | 1089 | 1.0E-10 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 749 | 958 | 1.0E-10 |
sp|Q05946|UTP13_YEAST | U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 | 850 | 1052 | 1.0E-10 |
sp|Q6BU94|PRP46_DEBHA | Pre-mRNA-splicing factor PRP46 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP46 PE=3 SV=2 | 864 | 1044 | 1.0E-10 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 850 | 1048 | 1.0E-10 |
sp|P26308|GBB1_DROME | Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 | 752 | 1003 | 1.0E-10 |
sp|B2RZ17|FBXW2_RAT | F-box/WD repeat-containing protein 2 OS=Rattus norvegicus GN=Fbxw2 PE=2 SV=1 | 891 | 1021 | 1.0E-10 |
sp|Q6NRT3|SMU1_XENLA | WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 | 788 | 974 | 1.0E-10 |
sp|Q16MY0|WDR48_AEDAE | WD repeat-containing protein 48 homolog OS=Aedes aegypti GN=AAEL012158 PE=3 SV=1 | 739 | 1052 | 1.0E-10 |
sp|Q6P4J8|SMU1_XENTR | WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 | 788 | 974 | 1.0E-10 |
sp|Q54SF9|MHCKD_DICDI | Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 | 744 | 963 | 1.0E-10 |
sp|Q7RY68|PFS2_NEUCR | Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 | 894 | 1091 | 1.0E-10 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 930 | 1050 | 2.0E-10 |
sp|D3TLL6|LIS1_GLOMM | Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 | 930 | 1050 | 2.0E-10 |
sp|Q0U2T3|MDV1_PHANO | Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 | 775 | 1002 | 2.0E-10 |
sp|Q39190|PRL2_ARATH | Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 | 878 | 1049 | 2.0E-10 |
sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 891 | 1053 | 2.0E-10 |
sp|Q9SJT9|COPA2_ARATH | Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 | 894 | 1003 | 2.0E-10 |
sp|Q6FLI3|CAF4_CANGA | CCR4-associated factor 4 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAF4 PE=3 SV=1 | 923 | 1052 | 2.0E-10 |
sp|Q5ZME8|SMU1_CHICK | WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 | 788 | 974 | 2.0E-10 |
sp|Q99M63|SMU1_RAT | WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 | 810 | 1013 | 2.0E-10 |
sp|Q3UKJ7|SMU1_MOUSE | WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 | 810 | 1013 | 2.0E-10 |
sp|Q2TAY7|SMU1_HUMAN | WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 | 810 | 1013 | 2.0E-10 |
sp|Q76B40|SMU1_CRIGR | WD40 repeat-containing protein SMU1 OS=Cricetulus griseus GN=SMU1 PE=2 SV=1 | 810 | 1013 | 2.0E-10 |
sp|Q2TBS9|SMU1_BOVIN | WD40 repeat-containing protein SMU1 OS=Bos taurus GN=SMU1 PE=2 SV=1 | 810 | 1013 | 2.0E-10 |
sp|Q7ZVA0|SMU1_DANRE | WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 | 788 | 974 | 2.0E-10 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 726 | 921 | 3.0E-10 |
sp|P0CS44|MDV1_CRYNJ | Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MDV1 PE=3 SV=1 | 773 | 1041 | 3.0E-10 |
sp|P0CS45|MDV1_CRYNB | Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MDV1 PE=3 SV=1 | 773 | 1041 | 3.0E-10 |
sp|A6ZQL5|MDV1_YEAS7 | Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 | 905 | 1065 | 3.0E-10 |
sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 832 | 1053 | 3.0E-10 |
sp|A7TNS8|CAF4_VANPO | CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1 | 905 | 1065 | 3.0E-10 |
sp|P16649|TUP1_YEAST | General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 | 926 | 1052 | 3.0E-10 |
sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 748 | 1005 | 3.0E-10 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 749 | 958 | 3.0E-10 |
sp|Q4ICM0|LIS1_GIBZE | Nuclear distribution protein PAC1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAC1 PE=3 SV=2 | 890 | 1043 | 3.0E-10 |
sp|Q9AUR8|COPA1_ORYSJ | Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 | 894 | 1003 | 3.0E-10 |
sp|Q0J3D9|COPA3_ORYSJ | Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 | 894 | 1003 | 3.0E-10 |
sp|Q6NRT3|SMU1_XENLA | WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 | 810 | 1013 | 3.0E-10 |
sp|Q6CG48|LIS1_YARLI | Nuclear distribution protein PAC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAC1 PE=3 SV=1 | 733 | 1022 | 3.0E-10 |
sp|Q12220|UTP12_YEAST | U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 | 790 | 1060 | 3.0E-10 |
sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 931 | 1052 | 4.0E-10 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 930 | 1052 | 4.0E-10 |
sp|Q5ZME8|SMU1_CHICK | WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 | 810 | 1013 | 4.0E-10 |
sp|Q6FWT9|LIS1_CANGA | Nuclear distribution protein PAC1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAC1 PE=3 SV=1 | 893 | 1050 | 4.0E-10 |
sp|Q20168|COPB2_CAEEL | Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 | 717 | 862 | 5.0E-10 |
sp|Q9SJT9|COPA2_ARATH | Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 | 895 | 1043 | 5.0E-10 |
sp|Q9AUR7|COPA2_ORYSJ | Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 | 894 | 1008 | 5.0E-10 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 908 | 1091 | 6.0E-10 |
sp|Q9UTC7|YIDC_SCHPO | Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 | 901 | 1052 | 6.0E-10 |
sp|Q55FR9|COPA_DICDI | Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 | 847 | 1060 | 6.0E-10 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 843 | 1065 | 6.0E-10 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 843 | 1065 | 6.0E-10 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 843 | 1065 | 6.0E-10 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 930 | 1050 | 7.0E-10 |
sp|Q9AUR8|COPA1_ORYSJ | Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 | 895 | 1043 | 7.0E-10 |
sp|Q96WV5|COPA_SCHPO | Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 | 825 | 1011 | 7.0E-10 |
sp|Q6P4J8|SMU1_XENTR | WD40 repeat-containing protein SMU1 OS=Xenopus tropicalis GN=smu1 PE=2 SV=1 | 810 | 1013 | 7.0E-10 |
sp|Q5A7Q3|PRP46_CANAL | Pre-mRNA-splicing factor PRP46 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP46 PE=3 SV=1 | 887 | 1044 | 8.0E-10 |
sp|Q0J3D9|COPA3_ORYSJ | Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 | 895 | 1043 | 8.0E-10 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 952 | 1065 | 1.0E-09 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 951 | 1044 | 1.0E-09 |
sp|D4D8P3|SCONB_TRIVH | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Trichophyton verrucosum (strain HKI 0517) GN=sconB PE=3 SV=1 | 951 | 1044 | 1.0E-09 |
sp|Q0U2T3|MDV1_PHANO | Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 | 922 | 1052 | 1.0E-09 |
sp|Q6Q0C0|TRAF7_HUMAN | E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens GN=TRAF7 PE=1 SV=1 | 893 | 1078 | 1.0E-09 |
sp|Q10281|GBLP_SCHPO | Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 | 930 | 1048 | 1.0E-09 |
sp|Q0D0X6|LIS1_ASPTN | Nuclear distribution protein nudF OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nudF PE=3 SV=1 | 927 | 1083 | 1.0E-09 |
sp|C4JZS6|LIS11_UNCRE | Nuclear distribution protein PAC1-1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-1 PE=3 SV=1 | 929 | 1090 | 1.0E-09 |
sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 750 | 1003 | 1.0E-09 |
sp|Q9H2Y7|ZN106_HUMAN | Zinc finger protein 106 OS=Homo sapiens GN=ZNF106 PE=1 SV=1 | 734 | 945 | 1.0E-09 |
sp|Q9BZK7|TBL1R_HUMAN | F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 | 844 | 1089 | 1.0E-09 |
sp|Q7SZM9|TB1RA_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 | 844 | 1089 | 1.0E-09 |
sp|Q8RXA7|SCD1_ARATH | DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 | 927 | 1098 | 1.0E-09 |
sp|Q6GPC6|TB1RB_XENLA | F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 | 844 | 1089 | 1.0E-09 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 745 | 1002 | 1.0E-09 |
sp|Q9AUR7|COPA2_ORYSJ | Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 | 895 | 1043 | 1.0E-09 |
sp|Q94A40|COPA1_ARATH | Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 | 894 | 1003 | 1.0E-09 |
sp|O88466|ZN106_MOUSE | Zinc finger protein 106 OS=Mus musculus GN=Znf106 PE=1 SV=3 | 734 | 945 | 1.0E-09 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 843 | 1065 | 1.0E-09 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 741 | 1041 | 1.0E-09 |
sp|Q9FNZ1|C3H63_ARATH | Zinc finger CCCH domain-containing protein 63 OS=Arabidopsis thaliana GN=ZFWD2 PE=2 SV=1 | 750 | 1003 | 1.0E-09 |
sp|O15736|TIPD_DICDI | Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1 | 742 | 1022 | 1.0E-09 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 736 | 921 | 2.0E-09 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 930 | 1050 | 2.0E-09 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 930 | 1050 | 2.0E-09 |
sp|Q6CJ50|MDV1_KLULA | Mitochondrial division protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MDV1 PE=3 SV=1 | 742 | 815 | 2.0E-09 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 750 | 962 | 2.0E-09 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 750 | 962 | 2.0E-09 |
sp|Q922B6|TRAF7_MOUSE | E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus GN=Traf7 PE=1 SV=1 | 893 | 1083 | 2.0E-09 |
sp|Q9NSI6|BRWD1_HUMAN | Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 | 873 | 1002 | 2.0E-09 |
sp|P47025|MDV1_YEAST | Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 | 723 | 837 | 2.0E-09 |
sp|P0CS44|MDV1_CRYNJ | Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MDV1 PE=3 SV=1 | 878 | 1049 | 2.0E-09 |
sp|P0CS45|MDV1_CRYNB | Mitochondrial division protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MDV1 PE=3 SV=1 | 878 | 1049 | 2.0E-09 |
sp|A6ZQL5|MDV1_YEAS7 | Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 | 723 | 837 | 2.0E-09 |
sp|Q6RI45|BRWD3_HUMAN | Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens GN=BRWD3 PE=1 SV=2 | 868 | 1002 | 2.0E-09 |
sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 888 | 1044 | 2.0E-09 |
sp|D1ZEB4|LIS11_SORMK | Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 | 929 | 1067 | 2.0E-09 |
sp|Q6C709|PRP46_YARLI | Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRP46 PE=3 SV=2 | 926 | 1064 | 2.0E-09 |
sp|Q9BQ87|TBL1Y_HUMAN | F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 | 844 | 1085 | 2.0E-09 |
sp|Q01369|GBLP_NEUCR | Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 | 771 | 1016 | 2.0E-09 |
sp|Q9AUR7|COPA2_ORYSJ | Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 | 801 | 1046 | 2.0E-09 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 885 | 1053 | 2.0E-09 |
sp|Q94A40|COPA1_ARATH | Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=2 SV=2 | 895 | 1043 | 2.0E-09 |
sp|Q8IZU2|WDR17_HUMAN | WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 | 737 | 923 | 2.0E-09 |
sp|Q6FJS0|PFS2_CANGA | Polyadenylation factor subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFS2 PE=3 SV=1 | 896 | 1077 | 2.0E-09 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 900 | 1045 | 2.0E-09 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 732 | 921 | 3.0E-09 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 930 | 1050 | 3.0E-09 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 930 | 1050 | 3.0E-09 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 930 | 1050 | 3.0E-09 |
sp|Q921C3|BRWD1_MOUSE | Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 | 873 | 1002 | 3.0E-09 |
sp|A2AHJ4|BRWD3_MOUSE | Bromodomain and WD repeat-containing protein 3 OS=Mus musculus GN=Brwd3 PE=1 SV=1 | 868 | 1002 | 3.0E-09 |
sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 888 | 1044 | 3.0E-09 |
sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 888 | 1044 | 3.0E-09 |
sp|Q86TI4|WDR86_HUMAN | WD repeat-containing protein 86 OS=Homo sapiens GN=WDR86 PE=2 SV=3 | 925 | 1047 | 4.0E-09 |
sp|Q7RY30|LIS11_NEUCR | Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 | 929 | 1052 | 4.0E-09 |
sp|O62621|COPB2_DROME | Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 | 717 | 862 | 4.0E-09 |
sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 810 | 1064 | 4.0E-09 |
sp|Q9AUR8|COPA1_ORYSJ | Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 | 801 | 1046 | 4.0E-09 |
sp|Q9HAV0|GBB4_HUMAN | Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 | 770 | 1047 | 4.0E-09 |
sp|Q60584|FBXW2_MOUSE | F-box/WD repeat-containing protein 2 OS=Mus musculus GN=Fbxw2 PE=2 SV=2 | 740 | 822 | 4.0E-09 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 930 | 1050 | 5.0E-09 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 930 | 1050 | 5.0E-09 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 737 | 962 | 5.0E-09 |
sp|P38011|GBLP_YEAST | Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 | 765 | 1047 | 5.0E-09 |
sp|Q8BHJ5|TBL1R_MOUSE | F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 | 844 | 1089 | 5.0E-09 |
sp|P49027|GBLPA_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein A OS=Oryza sativa subsp. japonica GN=RACK1A PE=1 SV=1 | 745 | 964 | 5.0E-09 |
sp|Q58D00|FBXW2_BOVIN | F-box/WD repeat-containing protein 2 OS=Bos taurus GN=FBXW2 PE=2 SV=1 | 740 | 822 | 5.0E-09 |
sp|B2RZ17|FBXW2_RAT | F-box/WD repeat-containing protein 2 OS=Rattus norvegicus GN=Fbxw2 PE=2 SV=1 | 740 | 822 | 5.0E-09 |
sp|A8Q2R5|WDR48_BRUMA | WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 | 752 | 1051 | 5.0E-09 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 843 | 1043 | 5.0E-09 |
sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 754 | 962 | 5.0E-09 |
sp|A8XZJ9|LIS1_CAEBR | Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 | 929 | 1049 | 6.0E-09 |
sp|B6QC06|LIS12_TALMQ | Nuclear distribution protein nudF 2 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-2 PE=3 SV=1 | 927 | 1083 | 6.0E-09 |
sp|Q0J3D9|COPA3_ORYSJ | Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 | 801 | 1046 | 6.0E-09 |
sp|Q9UKT8|FBXW2_HUMAN | F-box/WD repeat-containing protein 2 OS=Homo sapiens GN=FBXW2 PE=1 SV=2 | 740 | 822 | 6.0E-09 |
sp|O15736|TIPD_DICDI | Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1 | 770 | 1052 | 6.0E-09 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 930 | 1050 | 7.0E-09 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 930 | 1050 | 7.0E-09 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 930 | 1050 | 7.0E-09 |
sp|Q8WWQ0|PHIP_HUMAN | PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 | 889 | 1007 | 7.0E-09 |
sp|Q8VDD9|PHIP_MOUSE | PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 | 889 | 1007 | 7.0E-09 |
sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 745 | 974 | 7.0E-09 |
sp|A1DP19|LIS1_NEOFI | Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 | 929 | 1072 | 7.0E-09 |
sp|Q00664|LIS1_EMENI | Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 | 927 | 1083 | 7.0E-09 |
sp|A7TNS8|CAF4_VANPO | CCR4-associated factor 4 homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CAF4 PE=3 SV=1 | 733 | 960 | 8.0E-09 |
sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 888 | 1047 | 8.0E-09 |
sp|Q5XGI5|WDR83_XENTR | WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 | 891 | 1053 | 8.0E-09 |
sp|B6GZD3|LIS12_PENRW | Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 | 832 | 1077 | 9.0E-09 |
sp|P53622|COPA_YEAST | Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 | 913 | 1043 | 9.0E-09 |
sp|P53622|COPA_YEAST | Coatomer subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COP1 PE=1 SV=2 | 800 | 1081 | 9.0E-09 |
sp|Q10051|PRP19_CAEEL | Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2 | 888 | 1044 | 9.0E-09 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 749 | 927 | 1.0E-08 |
sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 745 | 974 | 1.0E-08 |
sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 908 | 1052 | 1.0E-08 |
sp|O18640|GBLP_DROME | Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 | 745 | 974 | 1.0E-08 |
sp|Q4V7Z1|POC1B_XENLA | POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 | 883 | 1081 | 1.0E-08 |
sp|Q4WLM7|LIS1_ASPFU | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 | 929 | 1072 | 1.0E-08 |
sp|B0XM00|LIS1_ASPFC | Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 | 929 | 1072 | 1.0E-08 |
sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 752 | 1003 | 1.0E-08 |
sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 889 | 1050 | 1.0E-08 |
sp|P38011|GBLP_YEAST | Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 | 733 | 947 | 1.0E-08 |
sp|A2QP30|LIS1_ASPNC | Nuclear distribution protein nudF OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nudF PE=3 SV=1 | 927 | 1081 | 1.0E-08 |
sp|Q54SF9|MHCKD_DICDI | Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 | 748 | 1045 | 1.0E-08 |
sp|Q5BLX8|WDR83_RAT | WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 | 888 | 1053 | 1.0E-08 |
sp|P62882|GBB5_RAT | Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 | 792 | 1002 | 1.0E-08 |
sp|Q80ZD0|GBB5_TAMST | Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 | 792 | 1002 | 1.0E-08 |
sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 905 | 1081 | 1.0E-08 |
sp|Q9NDC9|LIS1_CAEEL | Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 | 929 | 1049 | 2.0E-08 |
sp|P78706|RCO1_NEUCR | Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 | 901 | 1072 | 2.0E-08 |
sp|D5GBI7|LIS1_TUBMM | Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 | 929 | 1052 | 2.0E-08 |
sp|Q2GT28|LIS12_CHAGB | Nuclear distribution protein PAC1-2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-2 PE=3 SV=1 | 929 | 1052 | 2.0E-08 |
sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 770 | 1047 | 2.0E-08 |
sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 770 | 1047 | 2.0E-08 |
sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 770 | 1047 | 2.0E-08 |
sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 770 | 1047 | 2.0E-08 |
sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 770 | 1047 | 2.0E-08 |
sp|B4QB64|WDR48_DROSI | WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 | 767 | 1034 | 2.0E-08 |
sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 752 | 1003 | 2.0E-08 |
sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 752 | 1003 | 2.0E-08 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 750 | 921 | 2.0E-08 |
sp|Q9DAJ4|WDR83_MOUSE | WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 | 888 | 1053 | 2.0E-08 |
sp|Q5RDY7|GBB5_PONAB | Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 | 792 | 1002 | 2.0E-08 |
sp|P62881|GBB5_MOUSE | Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 | 792 | 1002 | 2.0E-08 |
sp|O14775|GBB5_HUMAN | Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 | 792 | 1002 | 2.0E-08 |
sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 730 | 970 | 3.0E-08 |
sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 931 | 1052 | 3.0E-08 |
sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 931 | 1052 | 3.0E-08 |
sp|C5FWH1|LIS1_ARTOC | Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 | 922 | 1052 | 3.0E-08 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 931 | 1081 | 3.0E-08 |
sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 888 | 1044 | 3.0E-08 |
sp|A4RJV3|MDV1_MAGO7 | Mitochondrial division protein 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MDV1 PE=3 SV=3 | 741 | 821 | 3.0E-08 |
sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 770 | 1042 | 3.0E-08 |
sp|Q6S7B0|TAF5_ARATH | Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 | 903 | 1067 | 3.0E-08 |
sp|B4HND9|WDR48_DROSE | WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 | 767 | 1034 | 3.0E-08 |
sp|Q8MY12|MHCKC_DICDI | Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 | 742 | 962 | 3.0E-08 |
sp|O22212|PRP4L_ARATH | U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 | 749 | 1002 | 3.0E-08 |
sp|O88879|APAF_MOUSE | Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 | 736 | 1032 | 3.0E-08 |
sp|Q12220|UTP12_YEAST | U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIP2 PE=1 SV=1 | 917 | 1060 | 3.0E-08 |
sp|Q9JJA4|WDR12_MOUSE | Ribosome biogenesis protein WDR12 OS=Mus musculus GN=Wdr12 PE=1 SV=1 | 843 | 1058 | 3.0E-08 |
sp|Q4P8R5|MDV1_USTMA | Mitochondrial division protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDV1 PE=3 SV=1 | 776 | 964 | 4.0E-08 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 930 | 1077 | 4.0E-08 |
sp|A1CUD6|LIS11_ASPCL | Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 | 929 | 1072 | 4.0E-08 |
sp|O35142|COPB2_RAT | Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 | 731 | 941 | 4.0E-08 |
sp|Q6FLI3|CAF4_CANGA | CCR4-associated factor 4 homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAF4 PE=3 SV=1 | 717 | 809 | 4.0E-08 |
sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 770 | 1042 | 4.0E-08 |
sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 770 | 1042 | 4.0E-08 |
sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 750 | 1046 | 4.0E-08 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 772 | 1047 | 4.0E-08 |
sp|Q6PNB6|GBB5_RABIT | Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 | 792 | 1002 | 4.0E-08 |
sp|P16520|GBB3_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 | 770 | 1026 | 5.0E-08 |
sp|O13282|TAF5_SCHPO | Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 | 843 | 1043 | 5.0E-08 |
sp|Q55FR9|COPA_DICDI | Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 | 752 | 992 | 5.0E-08 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 772 | 1047 | 5.0E-08 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 930 | 1077 | 6.0E-08 |
sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 889 | 1064 | 6.0E-08 |
sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 889 | 1064 | 6.0E-08 |
sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 889 | 1064 | 6.0E-08 |
sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 889 | 1064 | 6.0E-08 |
sp|Q5GIS3|GBB_PINFU | Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 | 770 | 1043 | 6.0E-08 |
sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 722 | 1041 | 6.0E-08 |
sp|C7GWC1|LIS1_YEAS2 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain JAY291) GN=PAC1 PE=3 SV=1 | 704 | 956 | 6.0E-08 |
sp|P16520|GBB3_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1 | 889 | 1050 | 7.0E-08 |
sp|Q9SJT9|COPA2_ARATH | Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 | 801 | 1046 | 7.0E-08 |
sp|Q5GIS3|GBB_PINFU | Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 | 752 | 1003 | 7.0E-08 |
sp|Q8IZU2|WDR17_HUMAN | WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 | 734 | 964 | 8.0E-08 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 761 | 965 | 8.0E-08 |
sp|Q1LZ08|WDR48_DROME | WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 | 767 | 1034 | 9.0E-08 |
sp|P54313|GBB2_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Rattus norvegicus GN=Gnb2 PE=1 SV=4 | 752 | 1003 | 9.0E-08 |
sp|P62880|GBB2_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Mus musculus GN=Gnb2 PE=1 SV=3 | 752 | 1003 | 9.0E-08 |
sp|P62879|GBB2_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens GN=GNB2 PE=1 SV=3 | 752 | 1003 | 9.0E-08 |
sp|P11017|GBB2_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Bos taurus GN=GNB2 PE=2 SV=3 | 752 | 1003 | 9.0E-08 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 752 | 862 | 1.0E-07 |
sp|P0CS48|PRP46_CRYNJ | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP46 PE=3 SV=1 | 920 | 1063 | 1.0E-07 |
sp|P0CS49|PRP46_CRYNB | Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP46 PE=3 SV=1 | 920 | 1063 | 1.0E-07 |
sp|B6QC56|LIS11_TALMQ | Nuclear distribution protein nudF 1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=nudF-1 PE=3 SV=1 | 930 | 1052 | 1.0E-07 |
sp|Q61011|GBB3_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 | 770 | 1042 | 1.0E-07 |
sp|B3NSK1|WDR48_DROER | WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 | 767 | 1034 | 1.0E-07 |
sp|P49846|TAF5_DROME | Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 | 733 | 892 | 1.0E-07 |
sp|B3MET8|WDR48_DROAN | WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 | 767 | 1034 | 1.0E-07 |
sp|Q9HAV0|GBB4_HUMAN | Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 | 889 | 1064 | 1.0E-07 |
sp|Q5MNU5|SCAP_PIG | Sterol regulatory element-binding protein cleavage-activating protein OS=Sus scrofa GN=SCAP PE=2 SV=2 | 742 | 1013 | 1.0E-07 |
sp|A7RHG8|WDR12_NEMVE | Ribosome biogenesis protein WDR12 homolog (Fragment) OS=Nematostella vectensis GN=v1g82024 PE=3 SV=1 | 871 | 1093 | 1.0E-07 |
sp|Q5BLX8|WDR83_RAT | WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 | 745 | 1007 | 1.0E-07 |
sp|Q0U2T3|MDV1_PHANO | Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 | 850 | 1008 | 2.0E-07 |
sp|Q0U2T3|MDV1_PHANO | Mitochondrial division protein 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MDV1 PE=3 SV=2 | 741 | 809 | 2.0E-07 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 737 | 962 | 2.0E-07 |
sp|B4P7H8|WDR48_DROYA | WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 | 767 | 1034 | 2.0E-07 |
sp|P52287|GBB3_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 | 770 | 1042 | 2.0E-07 |
sp|Q8MY12|MHCKC_DICDI | Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 | 915 | 1089 | 2.0E-07 |
sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 743 | 926 | 2.0E-07 |
sp|O45040|GBB1_HOMAM | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 | 752 | 1003 | 2.0E-07 |
sp|Q93134|GBLP_BIOGL | Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 | 745 | 964 | 2.0E-07 |
sp|P26308|GBB1_DROME | Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 | 770 | 1047 | 2.0E-07 |
sp|Q9EPV5|APAF_RAT | Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 | 736 | 1003 | 2.0E-07 |
sp|P23232|GBB_LOLFO | Guanine nucleotide-binding protein subunit beta OS=Loligo forbesi PE=2 SV=1 | 770 | 1043 | 2.0E-07 |
sp|A6QM06|SCAP_BOVIN | Sterol regulatory element-binding protein cleavage-activating protein OS=Bos taurus GN=SCAP PE=2 SV=1 | 732 | 1013 | 2.0E-07 |
sp|P39946|LIS1_YEAST | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAC1 PE=1 SV=2 | 704 | 930 | 2.0E-07 |
sp|A6ZPA6|LIS1_YEAS7 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PAC1 PE=3 SV=1 | 704 | 930 | 2.0E-07 |
sp|B3LJT5|LIS1_YEAS1 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=PAC1 PE=3 SV=1 | 704 | 930 | 2.0E-07 |
sp|Q9DAJ4|WDR83_MOUSE | WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 | 745 | 1007 | 2.0E-07 |
sp|P61480|WDR12_RAT | Ribosome biogenesis protein WDR12 OS=Rattus norvegicus GN=Wdr12 PE=2 SV=1 | 850 | 1058 | 2.0E-07 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 480 | 569 | 3.0E-07 |
sp|B8M0Q1|LIS1_TALSN | Nuclear distribution protein nudF OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=nudF PE=3 SV=1 | 930 | 1072 | 3.0E-07 |
sp|O14435|GBB_CRYPA | Guanine nucleotide-binding protein subunit beta OS=Cryphonectria parasitica GN=GB-1 PE=3 SV=1 | 906 | 1041 | 3.0E-07 |
sp|P54311|GBB1_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 | 750 | 1003 | 3.0E-07 |
sp|P62874|GBB1_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 | 750 | 1003 | 3.0E-07 |
sp|P62873|GBB1_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 | 750 | 1003 | 3.0E-07 |
sp|P62872|GBB1_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 | 750 | 1003 | 3.0E-07 |
sp|P62871|GBB1_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 | 750 | 1003 | 3.0E-07 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 837 | 1064 | 3.0E-07 |
sp|Q6TMK6|GBB1_CRIGR | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 | 750 | 1003 | 3.0E-07 |
sp|Q5R5W8|GBB1_PONAB | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 | 750 | 1003 | 3.0E-07 |
sp|Q7S8R5|MDV1_NEUCR | Mitochondrial division protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mdv1 PE=3 SV=2 | 741 | 844 | 4.0E-07 |
sp|Q4P8R5|MDV1_USTMA | Mitochondrial division protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MDV1 PE=3 SV=1 | 952 | 1042 | 4.0E-07 |
sp|C6HTE8|LIS1_AJECH | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 | 930 | 1052 | 4.0E-07 |
sp|C0NRC6|LIS1_AJECG | Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 | 930 | 1052 | 4.0E-07 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 742 | 807 | 4.0E-07 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 742 | 923 | 4.0E-07 |
sp|P17343|GBB1_CAEEL | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=1 SV=2 | 889 | 1050 | 4.0E-07 |
sp|Q61ZF6|GBB1_CAEBR | Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1 | 889 | 1050 | 4.0E-07 |
sp|Q27954|COPA_BOVIN | Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 | 895 | 1043 | 4.0E-07 |
sp|P53621|COPA_HUMAN | Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 | 895 | 1043 | 4.0E-07 |
sp|C8ZH19|LIS1_YEAS8 | Nuclear distribution protein PAC1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=PAC1 PE=3 SV=1 | 704 | 930 | 4.0E-07 |
sp|O24076|GBLP_MEDSA | Guanine nucleotide-binding protein subunit beta-like protein OS=Medicago sativa GN=GB1 PE=2 SV=1 | 745 | 1000 | 5.0E-07 |
sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 928 | 1052 | 5.0E-07 |
sp|Q61011|GBB3_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2 | 889 | 1050 | 5.0E-07 |
sp|Q2UGU1|LIS1_ASPOR | Nuclear distribution protein nudF OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nudF PE=3 SV=2 | 930 | 1067 | 5.0E-07 |
sp|B8N9H4|LIS1_ASPFN | Nuclear distribution protein nudF OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=nudF PE=3 SV=2 | 930 | 1067 | 5.0E-07 |
sp|Q8CIE6|COPA_MOUSE | Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 | 895 | 1043 | 5.0E-07 |
sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 928 | 1052 | 6.0E-07 |
sp|Q7ZVA0|SMU1_DANRE | WD40 repeat-containing protein SMU1 OS=Danio rerio GN=smu1 PE=2 SV=1 | 731 | 1041 | 6.0E-07 |
sp|D4AM37|SCONB_ARTBC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=sconB PE=3 SV=1 | 752 | 864 | 7.0E-07 |
sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 928 | 1052 | 7.0E-07 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 740 | 839 | 7.0E-07 |
sp|P79147|GBB3_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis lupus familiaris GN=GNB3 PE=2 SV=1 | 889 | 1050 | 8.0E-07 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 740 | 839 | 8.0E-07 |
sp|B4MFM2|WDR48_DROVI | WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 | 767 | 1034 | 8.0E-07 |
sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 849 | 1064 | 8.0E-07 |
sp|Q9HAV0|GBB4_HUMAN | Guanine nucleotide-binding protein subunit beta-4 OS=Homo sapiens GN=GNB4 PE=1 SV=3 | 750 | 1003 | 8.0E-07 |
sp|Q5NVD0|PRP4_PONAB | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 | 733 | 1005 | 8.0E-07 |
sp|Q9UNX4|WDR3_HUMAN | WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1 | 917 | 1096 | 8.0E-07 |
sp|A2QCU8|SCONB_ASPNC | Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sconB PE=3 SV=1 | 486 | 561 | 9.0E-07 |
sp|C5PFX0|LIS1_COCP7 | Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 | 929 | 1059 | 9.0E-07 |
sp|Q5F3K4|WDR48_CHICK | WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 | 908 | 1072 | 9.0E-07 |
sp|P39014|MET30_YEAST | F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET30 PE=1 SV=1 | 478 | 589 | 1.0E-06 |
sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 745 | 974 | 1.0E-06 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 737 | 962 | 1.0E-06 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 883 | 1052 | 1.0E-06 |
sp|P52287|GBB3_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1 | 889 | 1050 | 1.0E-06 |
sp|Q54S79|WDR3_DICDI | WD repeat-containing protein 3 homolog OS=Dictyostelium discoideum GN=wdr3 PE=3 SV=1 | 777 | 1042 | 1.0E-06 |
sp|Q6PFM9|WDR48_DANRE | WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 | 908 | 1072 | 1.0E-06 |
sp|O45040|GBB1_HOMAM | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1 | 770 | 1042 | 1.0E-06 |
sp|Q08706|GBB_LYMST | Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 | 889 | 1050 | 1.0E-06 |
sp|Q6ZMY6|WDR88_HUMAN | WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 | 928 | 1051 | 1.0E-06 |
sp|Q0DYP5|C3H17_ORYSJ | Zinc finger CCCH domain-containing protein 17 OS=Oryza sativa subsp. japonica GN=Os02g0677700 PE=2 SV=2 | 882 | 1041 | 1.0E-06 |
sp|P54311|GBB1_RAT | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Rattus norvegicus GN=Gnb1 PE=1 SV=4 | 889 | 1050 | 1.0E-06 |
sp|P62874|GBB1_MOUSE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Mus musculus GN=Gnb1 PE=1 SV=3 | 889 | 1050 | 1.0E-06 |
sp|P62873|GBB1_HUMAN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homo sapiens GN=GNB1 PE=1 SV=3 | 889 | 1050 | 1.0E-06 |
sp|P62872|GBB1_CANLF | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Canis lupus familiaris GN=GNB1 PE=2 SV=3 | 889 | 1050 | 1.0E-06 |
sp|P62871|GBB1_BOVIN | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3 | 889 | 1050 | 1.0E-06 |
sp|Q3MHE2|PRP4_BOVIN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 | 733 | 1005 | 1.0E-06 |
sp|Q6TMK6|GBB1_CRIGR | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3 | 889 | 1050 | 1.0E-06 |
sp|Q5R5W8|GBB1_PONAB | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Pongo abelii GN=GNB1 PE=2 SV=3 | 889 | 1050 | 1.0E-06 |
sp|O43172|PRP4_HUMAN | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 | 733 | 1005 | 1.0E-06 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 731 | 885 | 1.0E-06 |
sp|A7ETB3|MDV1_SCLS1 | Mitochondrial division protein 1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mdv1 PE=3 SV=1 | 741 | 809 | 2.0E-06 |
sp|Q4WVS4|MDV1_ASPFU | Mitochondrial division protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mdv1 PE=3 SV=2 | 964 | 1043 | 2.0E-06 |
sp|A7THX0|MDV1_VANPO | Mitochondrial division protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MDV1 PE=3 SV=1 | 734 | 815 | 2.0E-06 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 930 | 1081 | 2.0E-06 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 930 | 1081 | 2.0E-06 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 879 | 1081 | 2.0E-06 |
sp|D1ZEM6|LIS12_SORMK | Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 | 930 | 1053 | 2.0E-06 |
sp|Q6FT96|MDV1_CANGA | Mitochondrial division protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MDV1 PE=3 SV=1 | 741 | 806 | 2.0E-06 |
sp|Q7S7L4|LIS12_NEUCR | Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 | 930 | 1053 | 2.0E-06 |
sp|P79959|GBB1_XENLA | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 | 889 | 1050 | 2.0E-06 |
sp|Q08706|GBB_LYMST | Guanine nucleotide-binding protein subunit beta OS=Lymnaea stagnalis PE=2 SV=1 | 770 | 1043 | 2.0E-06 |
sp|O74319|TAF73_SCHPO | Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 | 877 | 1050 | 2.0E-06 |
sp|Q5BLX8|WDR83_RAT | WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 | 926 | 1045 | 2.0E-06 |
sp|Q8BHB4|WDR3_MOUSE | WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=1 SV=1 | 917 | 1096 | 2.0E-06 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 930 | 1052 | 3.0E-06 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 742 | 849 | 3.0E-06 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 930 | 1081 | 3.0E-06 |
sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 928 | 1052 | 3.0E-06 |
sp|A1CF18|LIS12_ASPCL | Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 | 930 | 1052 | 3.0E-06 |
sp|D4DG66|LIS1_TRIVH | Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 | 922 | 1052 | 3.0E-06 |
sp|D4AZ50|LIS1_ARTBC | Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 | 922 | 1052 | 3.0E-06 |
sp|Q5GIS3|GBB_PINFU | Guanine nucleotide-binding protein subunit beta OS=Pinctada fucata PE=1 SV=1 | 889 | 1050 | 3.0E-06 |
sp|P79959|GBB1_XENLA | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1 | 750 | 1003 | 3.0E-06 |
sp|Q54SF9|MHCKD_DICDI | Myosin heavy chain kinase D OS=Dictyostelium discoideum GN=mhkD PE=3 SV=1 | 927 | 1052 | 3.0E-06 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 777 | 1041 | 3.0E-06 |
sp|A8NEG8|LIS1_COPC7 | Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 | 748 | 962 | 4.0E-06 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 906 | 1047 | 4.0E-06 |
sp|P97260|SCAP_CRIGR | Sterol regulatory element-binding protein cleavage-activating protein OS=Cricetulus griseus GN=SCAP PE=1 SV=1 | 732 | 1013 | 4.0E-06 |
sp|Q6GQT6|SCAP_MOUSE | Sterol regulatory element-binding protein cleavage-activating protein OS=Mus musculus GN=Scap PE=1 SV=1 | 742 | 1013 | 4.0E-06 |
sp|Q9DAW6|PRP4_MOUSE | U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 | 733 | 1005 | 4.0E-06 |
sp|A1DDL6|MDV1_NEOFI | Mitochondrial division protein 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mdv1 PE=3 SV=1 | 964 | 1043 | 5.0E-06 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 969 | 1066 | 5.0E-06 |
sp|Q39836|GBLP_SOYBN | Guanine nucleotide-binding protein subunit beta-like protein OS=Glycine max PE=2 SV=1 | 745 | 974 | 6.0E-06 |
sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 745 | 974 | 7.0E-06 |
sp|P26308|GBB1_DROME | Guanine nucleotide-binding protein subunit beta-1 OS=Drosophila melanogaster GN=Gbeta13F PE=1 SV=1 | 889 | 1050 | 8.0E-06 |
sp|B8P4B0|LIS11_POSPM | Nuclear distribution protein PAC1-1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-1 PE=3 SV=1 | 930 | 1050 | 9.0E-06 |
sp|Q54D08|LST8_DICDI | Protein LST8 homolog OS=Dictyostelium discoideum GN=lst8 PE=1 SV=1 | 789 | 1064 | 9.0E-06 |
sp|Q05946|UTP13_YEAST | U3 small nucleolar RNA-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP13 PE=1 SV=1 | 748 | 921 | 1.0E-05 |
sp|O14727|APAF_HUMAN | Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 | 732 | 875 | 1.0E-05 |
GO Term | Description | Terminal node |
---|---|---|
GO:0005515 | protein binding | Yes |
GO:0003674 | molecular_function | No |
GO:0005488 | binding | No |
Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
---|---|---|---|---|---|---|---|---|---|---|---|
Cytoplasm|Nucleus | Nuclear localization signal | 0.5188 | 0.6506 | 0.0166 | 0.0276 | 0.217 | 0.0353 | 0.055 | 0.0783 | 0.1875 | 0.026 |
Orthofinder run ID | 4 |
Orthogroup | 1391 |
Change Orthofinder run |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|1085 MTPSPSPGGQAGEPRRPRSAQTVSVNIADASHNSSRRFQLQVSECVETKTVTTTTRLTRKFPHVFVRDPTPLERL DSKEYPLAMKPTPPELLGFSYNTLDDARDYDDDDDELDDDDDDDYDDAVEDTLEPVSSSIIRPLAKPKSRIASGT ITPTAPKPDPLTLDSSAALNGASRAARSPSEVYPRRTRQTRAGLVESPSTTTTNTTSAAAPPVSQSLPLPLPRAP RGLARSNLHAVSDKLRRSIIQGGTAATQAQGPGGGGTGSSLASRRGLGDRPARGGSGFLATPDTSELPPSSSNRS SRRSSVRLDRLNSSPPDSAAVTGAMPQPGLCDAAASPSGSDSLTVFSSNVATPPITDADAAPFADTDPDESLQQS VRSLHHRPAIDVVAAQDASLPSPRLSPTLAASQPVSADQDDDDATGSFRTSMTDHGPSWMHDAQAKLDRDAVEVD AYRELQDALTAKSSAAHPDAVSSPVVLDTQTLLEAFDSMKTEMKTFMMYQFLRRCPRSTLRVIADAVNPALKCDF LQQLPLELAYHVLSYLDCRDLCRAAQVSKHWRNIVDRNETGWKELFDRDGFALPPGELNKAVVQGWGWQDPVGAT GYERDLSMQGRLTSSDLELTRNLRHDGALPARVRTSKRKRGLNAYSASERSKRRAATALESATSREQTAQAEARQ HKSEGPLSAANAAAAAVPDPQLGLASLRQLHLFKSLYRRHHMIRQSWTSGDVRPSHMAFAAHPRHVITCLQFDDD KIITGSDDTLIHIYDTKTGKLRKRLEGHEGGVWALQYEGNILVSGSTDRSVRVWDIERGLCQQVFYGHTSTVRCL QILMPTETGRVAAGRAVMQPEKPLIITGSRDSQLRVWRLPQVGSRRYIQTHPPAQESDCPYFIRVLPGHSHSVRA ISAHGDTLVSGSYDSTVRVWRISTGESLQTLRGHSQKVYSVVLDHERNRCISGSMDSLVKIWDLATGSCLHTLEG HSLLVGLLDLRDERLVSAAADSTLRIWDPESGRCRHTLMAHTGAITCFQHDGRKVISGSEKTVKMWDVRTGECVQ DLLTDLSGVWQVKFDGRRCVAAVQRDQLTYVEILDFGAIRDGQPPEDLGKRILLNEHEVREIVEDGMA* |
Coding | >Hirsu2|1085 ATGACGCCCTCGCCCTCGCCTGGCGGCCAGGCCGGAGAGCCTCGGCGTCCCAGGAGCGCCCAGACGGTGTCGGTC AACATCGCCGACGCCTCGCACAACTCGAGCCGCCGCTTCCAGCTCCAGGTCAGCGAGTGCGTCGAGACCAAGACG GTCACCACCACCACTCGTCTCACCCGCAAGTTCCCTCACGTCTTCGTCCGCGATCCGACTCCGCTTGAGAGGCTC GACTCCAAGGAGTACCCGCTGGCCATGAAGCCGACGCCGCCAGAGCTACTCGGCTTCTCCTACAACACGCTCGAC GATGCCAGAGACTACGATGACGACGACGACGAACTCGACGACGACGACGACGACGACTATGATGATGCCGTCGAA GATACCCTCGAGCCCGTCTCGTCGTCCATAATCCGGCCCCTCGCCAAGCCCAAAAGCCGAATCGCCAGCGGGACC ATAACTCCCACTGCCCCCAAACCAGACCCCCTTACCCTCGACTCGTCGGCGGCCCTCAACGGGGCAAGTCGAGCC GCCCGCTCCCCGTCCGAGGTGTACCCCCGACGCACGCGACAAACACGTGCCGGCCTCGTCGAATCTCCGTCCACC ACGACCACGAACACTACATCCGCCGCCGCACCACCCGTGTCACAGTCCCTTCCCCTCCCCCTTCCCAGGGCTCCA CGAGGCCTTGCCCGGTCCAATCTGCACGCCGTGTCGGATAAGCTGCGCCGCTCCATCATCCAGGGCGGCACCGCC GCTACCCAGGCCCAAGGCCCCGGCGGGGGCGGTACCGGCAGCAGCCTCGCCAGCCGCCGCGGCCTCGGCGACCGA CCCGCCCGAGGCGGCTCTGGCTTCCTGGCCACCCCCGACACGTCGGAACTACCGCCCTCCTCCTCGAACCGCTCC TCGCGACGAAGCTCGGTGCGCTTGGATCGCCTCAACAGCTCACCGCCCGACTCCGCCGCCGTCACCGGTGCCATG CCCCAGCCAGGCCTCTGCGACGCCGCCGCGAGCCCCTCGGGAAGCGATTCGCTCACCGTCTTCAGCAGCAACGTT GCCACCCCGCCCATCACCGACGCCGACGCTGCCCCCTTTGCGGACACCGATCCCGACGAGTCTCTCCAGCAGTCT GTCCGCTCCCTGCACCACAGGCCCGCCATCGACGTGGTCGCGGCACAGGACGCCAGCCTCCCTAGTCCCAGGCTG TCTCCCACCTTGGCCGCGTCCCAGCCCGTCTCCGCCGATCAGGACGACGACGACGCCACCGGCAGCTTCCGGACC TCCATGACCGACCACGGCCCGTCTTGGATGCACGACGCCCAGGCGAAGCTGGATCGGGATGCGGTCGAGGTGGAC GCCTACCGAGAGCTGCAGGACGCGCTCACGGCAAAGTCGTCGGCCGCCCACCCGGATGCGGTCTCGTCCCCCGTC GTCCTGGACACCCAGACGCTGCTCGAGGCCTTTGATTCCATGAAAACGGAGATGAAGACTTTCATGATGTACCAG TTCCTCCGCCGGTGCCCCCGCTCGACGCTGCGTGTCATCGCCGACGCCGTCAACCCGGCTCTCAAGTGCGACTTC CTCCAGCAGCTCCCCCTCGAGCTCGCCTACCACGTGCTCTCCTACCTCGACTGCCGCGACCTCTGCCGCGCCGCC CAGGTGTCGAAGCACTGGCGCAACATCGTGGACCGCAACGAGACGGGCTGGAAGGAGCTTTTCGACCGCGACGGC TTTGCGCTGCCGCCCGGCGAGCTGAACAAGGCCGTCGTCCAAGGGTGGGGCTGGCAGGATCCGGTCGGGGCCACG GGCTACGAGAGGGACCTGAGCATGCAGGGCCGCTTGACGTCGTCCGACTTGGAGCTGACCCGCAACCTGCGGCAC GACGGCGCTCTGCCGGCCCGGGTCCGGACATCGAAGCGGAAGCGTGGGCTCAACGCCTACTCGGCATCGGAGCGG TCCAAGCGACGCGCCGCGACCGCCCTGGAGTCGGCCACCTCCCGGGAGCAGACGGCCCAGGCCGAGGCCCGGCAG CACAAGTCCGAAGGCCCGCTGTCGGCCGCTAACGCCGCCGCGGCCGCCGTGCCCGACCCCCAGCTGGGTCTGGCC AGCCTCCGCCAGCTGCATCTCTTCAAGTCGCTCTACCGCCGGCACCACATGATCCGGCAGAGTTGGACCAGCGGC GACGTCCGACCGTCGCACATGGCCTTCGCCGCCCACCCTCGTCACGTTATCACGTGCCTGCAGTTTGACGACGAT AAGATTATTACGGGGAGCGACGATACGCTCATACACATTTACGATACTAAGACGGGCAAGCTGCGCAAGCGGCTC GAGGGCCACGAGGGCGGCGTGTGGGCCCTGCAGTACGAGGGAAACATACTCGTGTCGGGCTCTACGGACCGCTCG GTGCGCGTGTGGGACATCGAGCGAGGCCTGTGCCAGCAAGTGTTCTACGGGCACACCAGTACCGTCCGCTGTCTG CAGATCCTGATGCCGACGGAGACGGGTAGGGTCGCGGCTGGGCGCGCGGTGATGCAGCCAGAGAAGCCGCTCATC ATCACGGGCTCGCGCGACAGCCAGCTGCGGGTGTGGCGCCTGCCCCAGGTGGGGTCGCGGCGGTACATCCAGACG CACCCGCCCGCGCAGGAGTCGGACTGCCCGTACTTCATCCGCGTCCTGCCCGGTCACTCGCACTCGGTGCGGGCC ATCTCGGCGCACGGCGACACGCTCGTCAGCGGGTCGTATGACAGCACAGTGCGCGTGTGGCGGATCAGCACCGGC GAGTCGCTGCAAACCCTGCGCGGCCACTCGCAGAAGGTGTACTCAGTCGTGCTGGACCACGAGCGGAACCGCTGC ATCTCGGGGTCGATGGACTCGCTCGTCAAGATCTGGGACCTGGCGACGGGCTCGTGCCTGCATACACTTGAGGGC CACAGCCTGCTCGTCGGACTATTGGACCTCCGGGACGAGCGGCTGGTGTCGGCGGCGGCGGATTCGACGCTGCGG ATCTGGGACCCGGAGTCGGGACGGTGCCGGCACACGCTTATGGCGCACACGGGGGCCATCACCTGTTTCCAGCAC GACGGGCGCAAGGTGATCAGCGGCAGCGAGAAGACGGTCAAGATGTGGGACGTGAGGACTGGGGAGTGCGTGCAG GACCTGCTGACGGACCTGAGCGGCGTGTGGCAGGTCAAGTTTGACGGGAGGCGATGTGTGGCGGCCGTCCAGCGC GACCAGTTGACCTACGTCGAGATACTGGACTTTGGCGCGATTCGAGACGGCCAGCCCCCGGAAGACCTGGGCAAG CGCATTCTTCTGAACGAACACGAGGTGCGGGAGATTGTGGAAGACGGCATGGCCTAA |
Transcript | >Hirsu2|1085 ATGACGCCCTCGCCCTCGCCTGGCGGCCAGGCCGGAGAGCCTCGGCGTCCCAGGAGCGCCCAGACGGTGTCGGTC AACATCGCCGACGCCTCGCACAACTCGAGCCGCCGCTTCCAGCTCCAGGTCAGCGAGTGCGTCGAGACCAAGACG GTCACCACCACCACTCGTCTCACCCGCAAGTTCCCTCACGTCTTCGTCCGCGATCCGACTCCGCTTGAGAGGCTC GACTCCAAGGAGTACCCGCTGGCCATGAAGCCGACGCCGCCAGAGCTACTCGGCTTCTCCTACAACACGCTCGAC GATGCCAGAGACTACGATGACGACGACGACGAACTCGACGACGACGACGACGACGACTATGATGATGCCGTCGAA GATACCCTCGAGCCCGTCTCGTCGTCCATAATCCGGCCCCTCGCCAAGCCCAAAAGCCGAATCGCCAGCGGGACC ATAACTCCCACTGCCCCCAAACCAGACCCCCTTACCCTCGACTCGTCGGCGGCCCTCAACGGGGCAAGTCGAGCC GCCCGCTCCCCGTCCGAGGTGTACCCCCGACGCACGCGACAAACACGTGCCGGCCTCGTCGAATCTCCGTCCACC ACGACCACGAACACTACATCCGCCGCCGCACCACCCGTGTCACAGTCCCTTCCCCTCCCCCTTCCCAGGGCTCCA CGAGGCCTTGCCCGGTCCAATCTGCACGCCGTGTCGGATAAGCTGCGCCGCTCCATCATCCAGGGCGGCACCGCC GCTACCCAGGCCCAAGGCCCCGGCGGGGGCGGTACCGGCAGCAGCCTCGCCAGCCGCCGCGGCCTCGGCGACCGA CCCGCCCGAGGCGGCTCTGGCTTCCTGGCCACCCCCGACACGTCGGAACTACCGCCCTCCTCCTCGAACCGCTCC TCGCGACGAAGCTCGGTGCGCTTGGATCGCCTCAACAGCTCACCGCCCGACTCCGCCGCCGTCACCGGTGCCATG CCCCAGCCAGGCCTCTGCGACGCCGCCGCGAGCCCCTCGGGAAGCGATTCGCTCACCGTCTTCAGCAGCAACGTT GCCACCCCGCCCATCACCGACGCCGACGCTGCCCCCTTTGCGGACACCGATCCCGACGAGTCTCTCCAGCAGTCT GTCCGCTCCCTGCACCACAGGCCCGCCATCGACGTGGTCGCGGCACAGGACGCCAGCCTCCCTAGTCCCAGGCTG TCTCCCACCTTGGCCGCGTCCCAGCCCGTCTCCGCCGATCAGGACGACGACGACGCCACCGGCAGCTTCCGGACC TCCATGACCGACCACGGCCCGTCTTGGATGCACGACGCCCAGGCGAAGCTGGATCGGGATGCGGTCGAGGTGGAC GCCTACCGAGAGCTGCAGGACGCGCTCACGGCAAAGTCGTCGGCCGCCCACCCGGATGCGGTCTCGTCCCCCGTC GTCCTGGACACCCAGACGCTGCTCGAGGCCTTTGATTCCATGAAAACGGAGATGAAGACTTTCATGATGTACCAG TTCCTCCGCCGGTGCCCCCGCTCGACGCTGCGTGTCATCGCCGACGCCGTCAACCCGGCTCTCAAGTGCGACTTC CTCCAGCAGCTCCCCCTCGAGCTCGCCTACCACGTGCTCTCCTACCTCGACTGCCGCGACCTCTGCCGCGCCGCC CAGGTGTCGAAGCACTGGCGCAACATCGTGGACCGCAACGAGACGGGCTGGAAGGAGCTTTTCGACCGCGACGGC TTTGCGCTGCCGCCCGGCGAGCTGAACAAGGCCGTCGTCCAAGGGTGGGGCTGGCAGGATCCGGTCGGGGCCACG GGCTACGAGAGGGACCTGAGCATGCAGGGCCGCTTGACGTCGTCCGACTTGGAGCTGACCCGCAACCTGCGGCAC GACGGCGCTCTGCCGGCCCGGGTCCGGACATCGAAGCGGAAGCGTGGGCTCAACGCCTACTCGGCATCGGAGCGG TCCAAGCGACGCGCCGCGACCGCCCTGGAGTCGGCCACCTCCCGGGAGCAGACGGCCCAGGCCGAGGCCCGGCAG CACAAGTCCGAAGGCCCGCTGTCGGCCGCTAACGCCGCCGCGGCCGCCGTGCCCGACCCCCAGCTGGGTCTGGCC AGCCTCCGCCAGCTGCATCTCTTCAAGTCGCTCTACCGCCGGCACCACATGATCCGGCAGAGTTGGACCAGCGGC GACGTCCGACCGTCGCACATGGCCTTCGCCGCCCACCCTCGTCACGTTATCACGTGCCTGCAGTTTGACGACGAT AAGATTATTACGGGGAGCGACGATACGCTCATACACATTTACGATACTAAGACGGGCAAGCTGCGCAAGCGGCTC GAGGGCCACGAGGGCGGCGTGTGGGCCCTGCAGTACGAGGGAAACATACTCGTGTCGGGCTCTACGGACCGCTCG GTGCGCGTGTGGGACATCGAGCGAGGCCTGTGCCAGCAAGTGTTCTACGGGCACACCAGTACCGTCCGCTGTCTG CAGATCCTGATGCCGACGGAGACGGGTAGGGTCGCGGCTGGGCGCGCGGTGATGCAGCCAGAGAAGCCGCTCATC ATCACGGGCTCGCGCGACAGCCAGCTGCGGGTGTGGCGCCTGCCCCAGGTGGGGTCGCGGCGGTACATCCAGACG CACCCGCCCGCGCAGGAGTCGGACTGCCCGTACTTCATCCGCGTCCTGCCCGGTCACTCGCACTCGGTGCGGGCC ATCTCGGCGCACGGCGACACGCTCGTCAGCGGGTCGTATGACAGCACAGTGCGCGTGTGGCGGATCAGCACCGGC GAGTCGCTGCAAACCCTGCGCGGCCACTCGCAGAAGGTGTACTCAGTCGTGCTGGACCACGAGCGGAACCGCTGC ATCTCGGGGTCGATGGACTCGCTCGTCAAGATCTGGGACCTGGCGACGGGCTCGTGCCTGCATACACTTGAGGGC CACAGCCTGCTCGTCGGACTATTGGACCTCCGGGACGAGCGGCTGGTGTCGGCGGCGGCGGATTCGACGCTGCGG ATCTGGGACCCGGAGTCGGGACGGTGCCGGCACACGCTTATGGCGCACACGGGGGCCATCACCTGTTTCCAGCAC GACGGGCGCAAGGTGATCAGCGGCAGCGAGAAGACGGTCAAGATGTGGGACGTGAGGACTGGGGAGTGCGTGCAG GACCTGCTGACGGACCTGAGCGGCGTGTGGCAGGTCAAGTTTGACGGGAGGCGATGTGTGGCGGCCGTCCAGCGC GACCAGTTGACCTACGTCGAGATACTGGACTTTGGCGCGATTCGAGACGGCCAGCCCCCGGAAGACCTGGGCAAG CGCATTCTTCTGAACGAACACGAGGTGCGGGAGATTGTGGAAGACGGCATGGCCTAA |
Gene | >Hirsu2|1085 ATGACGCCCTCGCCCTCGCCTGGCGGCCAGGCCGGAGAGCCTCGGCGTCCCAGGAGCGCCCAGACGGTGTCGGTC AACATCGCCGACGCCTCGCACAACTCGAGCCGCCGCTTCCAGCTCCAGGTCAGCGAGTGCGTCGAGACCAAGACG GTCACCACCACCACTCGTCTCACCCGCAAGTTCCCTCACGTCTTCGTCCGCGATCCGACTCCGCTTGAGAGGCTC GACTCCAAGGAGTACCCGCTGGCCATGAAGCCGACGCCGCCAGAGCTACTCGGCTTCTCCTACAACACGCTCGAC GATGCCAGAGACTACGATGACGACGACGACGAACTCGACGACGACGACGACGACGACTATGATGATGCCGTCGAA GATACCCTCGAGCCCGTCTCGTCGTCCATAATCCGGCCCCTCGCCAAGCCCGTGAGTAGCCCCTTGCCTCCGCCT CGGACAACATGCCATCGTCAACACAAAATGAAATGGAAGCCGTCAGCCCCAGCGGCTCGAGGCCGATACCCGCCC CTCGCTGTGCGCGACGAGCAGAAGGGCAGAGTCTCTGCGCCCCCCCCCCCCCTCTTCCCCCTTTCGCCACTCCCC TCACTCTCGATTACCGTGTTTGCTCATCATGCATCCTGCTCTCTAGAAAAGCCGAATCGCCAGCGGGACCATAAC TCCCACTGCCCCCAAACCAGACCCCCTTACCCTCGACTCGTCGGCGGCCCTCAACGGGGCAAGTCGAGCCGCCCG CTCCCCGTCCGAGGTGTACCCCCGACGCACGCGACAAACACGTGCCGGCCTCGTCGAATCTCCGTCCACCACGAC CACGAACACTACATCCGCCGCCGCACCACCCGTGTCACAGTCCCTTCCCCTCCCCCTTCCCAGGGCTCCACGAGG CCTTGCCCGGTCCAATCTGCACGCCGTGTCGGATAAGCTGCGCCGCTCCATCATCCAGGGCGGCACCGCCGCTAC CCAGGCCCAAGGCCCCGGCGGGGGCGGTACCGGCAGCAGCCTCGCCAGCCGCCGCGGCCTCGGCGACCGACCCGC CCGAGGCGGCTCTGGCTTCCTGGCCACCCCCGACACGTCGGAACTACCGCCCTCCTCCTCGAACCGCTCCTCGCG ACGAAGCTCGGTGCGCTTGGATCGCCTCAACAGCTCACCGCCCGACTCCGCCGCCGTCACCGGTGCCATGCCCCA GCCAGGCCTCTGCGACGCCGCCGCGAGCCCCTCGGGAAGCGATTCGCTCACCGTCTTCAGCAGCAACGTTGCCAC CCCGCCCATCACCGACGCCGACGCTGCCCCCTTTGCGGACACCGATCCCGACGAGTCTCTCCAGCAGTCTGTCCG CTCCCTGCACCACAGGCCCGCCATCGACGTGGTCGCGGCACAGGACGCCAGCCTCCCTAGTCCCAGGCTGTCTCC CACCTTGGCCGCGTCCCAGCCCGTCTCCGCCGATCAGGACGACGACGACGCCACCGGCAGCTTCCGGACCTCCAT GACCGACCACGGCCCGTCTTGGATGCACGACGCCCAGGCGAAGCTGGATCGGGATGCGGTCGAGGTGGACGCCTA CCGAGAGCTGCAGGACGCGCTCACGGCAAAGTCGTCGGCCGCCCACCCGGATGCGGTCTCGTCCCCCGTCGTCCT GGACACCCAGACGCTGCTCGAGGCCTTTGATTCCATGAAAACGGAGATGAAGACTTTCATGATGTACCAGTTCCT CCGCCGGTGCCCCCGCTCGACGCTGCGTGTCATCGCCGACGCCGTCAACCCGGCTCTCAAGTGCGACTTCCTCCA GCAGCTCCCCCTCGAGCTCGCCTACCACGTGCTCTCCTACCTCGACTGCCGCGACCTCTGCCGCGCCGCCCAGGT GTCGAAGCACTGGCGCAACATCGTGGACCGCAACGAGACGGGCTGGAAGGAGCTTTTCGACCGCGACGGCTTTGC GCTGCCGCCCGGCGAGCTGAACAAGGCCGTCGTCCAAGGGTGGGGCTGGCAGGATCCGGTCGGGGCCACGGGCTA CGAGAGGGACCTGAGCATGCAGGGCCGCTTGACGTCGTCCGACTTGGAGCTGACCCGCAACCTGCGGCACGACGG CGCTCTGCCGGCCCGGGTCCGGACATCGAAGCGGAAGCGTGGGCTCAACGCCTACTCGGCATCGGAGCGGTCCAA GCGACGCGCCGCGACCGCCCTGGAGTCGGCCACCTCCCGGGAGCAGACGGCCCAGGCCGAGGCCCGGCAGCACAA GTCCGAAGGCCCGCTGTCGGCCGCTAACGCCGCCGCGGCCGCCGTGCCCGACCCCCAGCTGGGTCTGGCCAGCCT CCGCCAGCTGCATCTCTTCAAGTCGCTCTACCGCCGGCACCACATGATCCGGCAGAGTTGGACCAGCGGCGACGT CCGACCGTCGCACATGGCCTTCGCCGCCCACCCTCGTCACGTTATCACGTGCCTGCAGTTTGACGACGATAAGAT TATTACGGGGAGCGACGATACGCTCATACACATTTACGATACTAAGACGGGCAAGCTGCGCAAGCGGCTCGAGGG CCACGAGGGCGGCGTGTGGGCCCTGCAGTACGAGGGAAACATACTCGTGTCGGGCTCTACGGACCGCTCGGTGCG CGTGTGGGACATCGAGCGAGGCCTGTGCCAGCAAGTGTTCTACGGGCACACCAGTACCGTCCGCTGTCTGCAGAT CCTGATGCCGACGGAGACGGGTAGGGTCGCGGCTGGGCGCGCGGTGATGCAGCCAGAGAAGCCGCTCATCATCAC GGGCTCGCGCGACAGCCAGCTGCGGGTGTGGCGCCTGCCCCAGGTGGGGTCGCGGCGGTACATCCAGACGCACCC GCCCGCGCAGGAGTCGGACTGCCCGTACTTCATCCGCGTCCTGCCCGGTCACTCGCACTCGGTGCGGGCCATCTC GGCGCACGGCGACACGCTCGTCAGCGGGTCGTATGACAGCACAGTGCGCGTGTGGCGGATCAGCACCGGCGAGTC GCTGCAAACCCTGCGCGGCCACTCGCAGAAGGTGTACTCAGTCGTGCTGGACCACGAGCGGAACCGCTGCATCTC GGGGTCGATGGACTCGCTCGTCAAGATCTGGGACCTGGCGACGGGCTCGTGCCTGCATACACTTGAGGGCCACAG CCTGCTCGTCGGACTATTGGACCTCCGGGACGAGCGGCTGGTGTCGGCGGCGGCGGATTCGACGCTGCGGATCTG GGACCCGGAGTCGGGACGGTGCCGGCACACGCTTATGGCGCACACGGGGGCCATCACCTGTTTCCAGCACGACGG GCGCAAGGTGATCAGCGGCAGCGAGAAGACGGTCAAGATGTGGGACGTGAGGACTGGGGAGTGCGTGCAGGACCT GCTGACGGACCTGAGCGGCGTGTGGCAGGTCAAGTTTGACGGGAGGCGATGTGTGGCGGCCGTCCAGCGCGACCA GTTGACCTACGTCGAGGTACGTGAGGGCAAGGCGCAGCTTTTGGAAAGCGCCCGACCCTTTTCTTTCTCTCTCAC TCTCCCCTCTACCCCCTCTCCTCTCCGGGCATCGATACGGCGGAGAGTTGTGCGAGATGGAGTGAAACTGACTCG TTGGCGGCGTTGACAGATACTGGACTTTGGCGCGATTCGAGACGGCCAGCCCCCGGAAGACCTGGGCAAGCGCAT TCTTCTGAACGAACACGAGGTGCGGGAGATTGTGGAAGACGGCATGGCCTAA |