Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10849
Gene name
LocationContig_913:9067..10926
Strand+
Gene length (bp)1859
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda 3.0E-20 526 575
PF14716 HHH_8 Helix-hairpin-helix domain 2.9E-18 441 506

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UGP5|DPOLL_HUMAN DNA polymerase lambda OS=Homo sapiens GN=POLL PE=1 SV=1 213 582 6.0E-29
sp|Q4R380|DPOLL_MACFA DNA polymerase lambda OS=Macaca fascicularis GN=POLL PE=2 SV=1 213 582 1.0E-28
sp|Q5RKI3|DPOLL_RAT DNA polymerase lambda OS=Rattus norvegicus GN=Poll PE=2 SV=1 213 582 1.0E-28
sp|Q9QXE2|DPOLL_MOUSE DNA polymerase lambda OS=Mus musculus GN=Poll PE=2 SV=1 213 582 2.0E-28
sp|Q27958|DPOLB_BOVIN DNA polymerase beta OS=Bos taurus GN=POLB PE=2 SV=3 438 590 7.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UGP5|DPOLL_HUMAN DNA polymerase lambda OS=Homo sapiens GN=POLL PE=1 SV=1 213 582 6.0E-29
sp|Q4R380|DPOLL_MACFA DNA polymerase lambda OS=Macaca fascicularis GN=POLL PE=2 SV=1 213 582 1.0E-28
sp|Q5RKI3|DPOLL_RAT DNA polymerase lambda OS=Rattus norvegicus GN=Poll PE=2 SV=1 213 582 1.0E-28
sp|Q9QXE2|DPOLL_MOUSE DNA polymerase lambda OS=Mus musculus GN=Poll PE=2 SV=1 213 582 2.0E-28
sp|Q27958|DPOLB_BOVIN DNA polymerase beta OS=Bos taurus GN=POLB PE=2 SV=3 438 590 7.0E-21
sp|Q8K409|DPOLB_MOUSE DNA polymerase beta OS=Mus musculus GN=Polb PE=1 SV=3 438 590 1.0E-20
sp|P06746|DPOLB_HUMAN DNA polymerase beta OS=Homo sapiens GN=POLB PE=1 SV=3 438 590 2.0E-20
sp|O57383|DPOLB_XENLA DNA polymerase beta OS=Xenopus laevis GN=polb PE=1 SV=3 438 590 2.0E-20
sp|P06766|DPOLB_RAT DNA polymerase beta OS=Rattus norvegicus GN=Polb PE=1 SV=4 438 597 3.0E-20
sp|Q6DRD3|DPOLB_DANRE DNA polymerase beta OS=Danio rerio GN=polb PE=2 SV=2 438 590 5.0E-18
sp|Q9JIW4|DPOLM_MOUSE DNA-directed DNA/RNA polymerase mu OS=Mus musculus GN=Polm PE=1 SV=2 441 596 1.0E-13
sp|Q9NP87|DPOLM_HUMAN DNA-directed DNA/RNA polymerase mu OS=Homo sapiens GN=POLM PE=1 SV=1 439 590 3.0E-13
sp|Q09693|DPO4_SCHPO DNA polymerase type-X family protein pol4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol4 PE=3 SV=1 424 595 1.0E-11
sp|Q92089|TDT_ONCMY DNA nucleotidylexotransferase OS=Oncorhynchus mykiss GN=dntt PE=2 SV=1 428 590 8.0E-11
sp|O57486|TDT_AMBME DNA nucleotidylexotransferase OS=Ambystoma mexicanum GN=DNTT PE=2 SV=2 429 590 1.0E-10
sp|O02789|TDT_MONDO DNA nucleotidylexotransferase OS=Monodelphis domestica GN=DNTT PE=2 SV=1 429 590 2.0E-10
sp|P42118|TDT_XENLA DNA nucleotidylexotransferase OS=Xenopus laevis GN=dntt PE=2 SV=1 429 585 7.0E-09
sp|P09838|TDT_MOUSE DNA nucleotidylexotransferase OS=Mus musculus GN=Dntt PE=1 SV=3 428 590 6.0E-08
sp|P06526|TDT_BOVIN DNA nucleotidylexotransferase OS=Bos taurus GN=DNTT PE=1 SV=2 428 590 5.0E-06
sp|P04053|TDT_HUMAN DNA nucleotidylexotransferase OS=Homo sapiens GN=DNTT PE=1 SV=3 428 590 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0034061 DNA polymerase activity Yes
GO:0005634 nucleus Yes
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0005575 cellular_component No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016779 nucleotidyltransferase activity No
GO:0044424 intracellular part No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0043227 membrane-bounded organelle No
GO:0043226 organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0097159 organic cyclic compound binding No
GO:0044464 cell part No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0043229 intracellular organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10849
MDPSAEEKVAYFELLRSLGGASPHDDGHGDNDELDALELRDRQLRFRFFRPPPPFPPAPADGRHVGRPAPEEQRG
AAPGPVIANTQPGPAARPLPSAGPADDSFADETVVPDSARPAPRSRRGRGHSTPAPAARRRLAAADAREQSPSLH
PGARKRKRGGAAAGAPRLRPAEEQVFSGLAFFYVPNNDIAPARRLRIGKAREYGAAWTRSYAGATHIVVDKNLDY
ADVAKVVPVAALARGGPKLVNEDYPIDCIQFRSLLDHGQKKYRVAGQPAVAGDDAVSGPPQAPESPDDGKRRDPA
PPPPGTPQRSDEPPSQASVVDATPLPAGPQPRSTGATARPRRESPGGAEDELSGFISMMQEFRHLPLDNDDDELA
GSEPERAETREDEDDVAASESESESARDGGGRKKAQAKSRRKGGRFEDRFACHHAGEQAALAENANARTVEVLQS
MADFYERVGDEWRTLGYRKAITTLKRQRVRIRSEEEAARLPHIGRRIAQKIEEIVTTDRLRRLEYAREEATDGAL
QLFLQVYGVGSRQARQWVAQGYRSLDELRKGGVRLTASQAIGVEHFDDLQQAIPRREVEALGAVLPPGRRELARH
*
Coding >Hirsu2|10849
ATGGACCCGAGCGCGGAGGAAAAGGTCGCCTACTTCGAGCTCCTCCGAAGCCTGGGCGGCGCGTCGCCGCACGAC
GACGGCCACGGCGACAACGACGAGCTGGACGCGCTGGAGCTGCGCGACAGGCAGCTGCGCTTCCGCTTCTTCAGG
CCGCCGCCGCCGTTCCCCCCCGCGCCGGCCGACGGCCGACATGTCGGCAGGCCTGCGCCGGAGGAGCAGCGCGGA
GCCGCCCCCGGGCCGGTGATTGCAAACACGCAGCCCGGGCCGGCCGCGAGGCCCTTGCCCTCGGCTGGCCCCGCA
GACGATTCTTTCGCCGACGAGACGGTCGTGCCGGACTCGGCTCGCCCCGCGCCCAGGTCGCGCCGTGGTCGCGGC
CACTCTACCCCGGCGCCGGCGGCGAGGAGGAGATTGGCAGCAGCGGACGCGCGCGAGCAATCGCCCTCCCTCCAC
CCGGGCGCGAGGAAGAGGAAGCGAGGCGGCGCAGCGGCAGGGGCGCCGAGGCTGCGCCCGGCGGAGGAGCAGGTC
TTCAGCGGCCTCGCCTTCTTCTACGTCCCGAACAACGACATCGCGCCGGCCAGGCGGCTCCGCATCGGCAAGGCC
AGGGAGTACGGCGCGGCGTGGACGCGGAGCTACGCCGGCGCGACGCACATCGTCGTCGACAAGAACCTCGACTAC
GCCGACGTCGCCAAGGTCGTGCCCGTCGCCGCCCTGGCCCGCGGGGGCCCGAAGCTGGTCAACGAGGACTACCCG
ATCGACTGCATACAGTTCCGCTCCCTGCTCGACCACGGCCAGAAAAAGTACCGGGTCGCCGGCCAGCCGGCCGTC
GCCGGAGACGATGCTGTCTCGGGCCCGCCGCAAGCGCCGGAGAGCCCCGACGACGGGAAGCGACGGGATCCTGCG
CCTCCCCCGCCGGGCACGCCCCAGAGGAGCGACGAGCCCCCTTCCCAAGCGAGCGTCGTGGACGCAACGCCGCTT
CCCGCGGGTCCGCAGCCCCGAAGCACCGGCGCGACGGCTCGCCCGCGGCGGGAGTCGCCGGGGGGGGCCGAGGAC
GAGCTGTCGGGCTTCATCTCCATGATGCAGGAGTTTCGGCATCTGCCGCTCGACAACGACGACGACGAGCTCGCG
GGGTCCGAACCCGAACGGGCCGAGACGAGGGAAGACGAGGACGATGTCGCTGCCTCGGAGTCGGAATCGGAATCG
GCTCGCGACGGCGGCGGCAGGAAGAAGGCGCAGGCGAAGAGCAGACGGAAAGGCGGCCGATTCGAGGACCGGTTC
GCCTGCCACCACGCCGGCGAGCAGGCGGCGCTGGCGGAGAACGCCAACGCGCGCACGGTGGAGGTGCTCCAGAGC
ATGGCCGACTTCTACGAGCGGGTGGGCGACGAGTGGAGGACGCTGGGGTACCGCAAGGCCATCACGACGCTGAAG
CGGCAGAGGGTCAGGATCCGCAGCGAGGAGGAGGCGGCGCGGCTGCCGCACATCGGGCGGCGGATCGCGCAGAAG
ATTGAGGAGATTGTGACGACGGACCGGCTGCGGCGGCTCGAGTACGCGCGCGAGGAGGCGACGGACGGAGCGCTC
CAGCTCTTCCTGCAGGTCTACGGCGTCGGCAGCAGGCAGGCCCGGCAGTGGGTGGCGCAGGGGTACCGCAGCCTC
GACGAGCTGAGGAAGGGCGGCGTCAGGCTGACGGCCAGCCAGGCGATCGGGGTCGAGCACTTCGACGACCTGCAG
CAGGCGATCCCGCGGCGCGAGGTGGAGGCGCTCGGGGCGGTGCTACCGCCGGGGCGCCGAGAGCTCGCGCGACAT
TGA
Transcript >Hirsu2|10849
ATGGACCCGAGCGCGGAGGAAAAGGTCGCCTACTTCGAGCTCCTCCGAAGCCTGGGCGGCGCGTCGCCGCACGAC
GACGGCCACGGCGACAACGACGAGCTGGACGCGCTGGAGCTGCGCGACAGGCAGCTGCGCTTCCGCTTCTTCAGG
CCGCCGCCGCCGTTCCCCCCCGCGCCGGCCGACGGCCGACATGTCGGCAGGCCTGCGCCGGAGGAGCAGCGCGGA
GCCGCCCCCGGGCCGGTGATTGCAAACACGCAGCCCGGGCCGGCCGCGAGGCCCTTGCCCTCGGCTGGCCCCGCA
GACGATTCTTTCGCCGACGAGACGGTCGTGCCGGACTCGGCTCGCCCCGCGCCCAGGTCGCGCCGTGGTCGCGGC
CACTCTACCCCGGCGCCGGCGGCGAGGAGGAGATTGGCAGCAGCGGACGCGCGCGAGCAATCGCCCTCCCTCCAC
CCGGGCGCGAGGAAGAGGAAGCGAGGCGGCGCAGCGGCAGGGGCGCCGAGGCTGCGCCCGGCGGAGGAGCAGGTC
TTCAGCGGCCTCGCCTTCTTCTACGTCCCGAACAACGACATCGCGCCGGCCAGGCGGCTCCGCATCGGCAAGGCC
AGGGAGTACGGCGCGGCGTGGACGCGGAGCTACGCCGGCGCGACGCACATCGTCGTCGACAAGAACCTCGACTAC
GCCGACGTCGCCAAGGTCGTGCCCGTCGCCGCCCTGGCCCGCGGGGGCCCGAAGCTGGTCAACGAGGACTACCCG
ATCGACTGCATACAGTTCCGCTCCCTGCTCGACCACGGCCAGAAAAAGTACCGGGTCGCCGGCCAGCCGGCCGTC
GCCGGAGACGATGCTGTCTCGGGCCCGCCGCAAGCGCCGGAGAGCCCCGACGACGGGAAGCGACGGGATCCTGCG
CCTCCCCCGCCGGGCACGCCCCAGAGGAGCGACGAGCCCCCTTCCCAAGCGAGCGTCGTGGACGCAACGCCGCTT
CCCGCGGGTCCGCAGCCCCGAAGCACCGGCGCGACGGCTCGCCCGCGGCGGGAGTCGCCGGGGGGGGCCGAGGAC
GAGCTGTCGGGCTTCATCTCCATGATGCAGGAGTTTCGGCATCTGCCGCTCGACAACGACGACGACGAGCTCGCG
GGGTCCGAACCCGAACGGGCCGAGACGAGGGAAGACGAGGACGATGTCGCTGCCTCGGAGTCGGAATCGGAATCG
GCTCGCGACGGCGGCGGCAGGAAGAAGGCGCAGGCGAAGAGCAGACGGAAAGGCGGCCGATTCGAGGACCGGTTC
GCCTGCCACCACGCCGGCGAGCAGGCGGCGCTGGCGGAGAACGCCAACGCGCGCACGGTGGAGGTGCTCCAGAGC
ATGGCCGACTTCTACGAGCGGGTGGGCGACGAGTGGAGGACGCTGGGGTACCGCAAGGCCATCACGACGCTGAAG
CGGCAGAGGGTCAGGATCCGCAGCGAGGAGGAGGCGGCGCGGCTGCCGCACATCGGGCGGCGGATCGCGCAGAAG
ATTGAGGAGATTGTGACGACGGACCGGCTGCGGCGGCTCGAGTACGCGCGCGAGGAGGCGACGGACGGAGCGCTC
CAGCTCTTCCTGCAGGTCTACGGCGTCGGCAGCAGGCAGGCCCGGCAGTGGGTGGCGCAGGGGTACCGCAGCCTC
GACGAGCTGAGGAAGGGCGGCGTCAGGCTGACGGCCAGCCAGGCGATCGGGGTCGAGCACTTCGACGACCTGCAG
CAGGCGATCCCGCGGCGCGAGGTGGAGGCGCTCGGGGCGGTGCTACCGCCGGGGCGCCGAGAGCTCGCGCGACAT
TGA
Gene >Hirsu2|10849
ATGGACCCGAGCGCGGAGGAAAAGGTCGCCTACTTCGAGCTCCTCCGAAGCCTGGGCGGCGCGTCGCCGCACGAC
GACGGCCACGGCGACAACGACGAGCTGGACGCGCTGGAGCTGCGCGACAGGCAGCTGCGCTTCCGCTTCTTCAGG
CCGCCGCCGCCGTTCCCCCCCGCGCCGGCCGACGGCCGACATGTCGGCAGGCCTGCGCCGGAGGAGCAGCGCGGA
GCCGCCCCCGGGCCGGTGATTGCAAACACGCAGCCCGGGCCGGCCGCGAGGCCCTTGCCCTCGGCTGGCCCCGCA
GACGATTCTTTCGCCGACGAGACGGTCGTGCCGGACTCGGCTCGCCCCGCGCCCAGGTCGCGCCGTGGTCGCGGC
CACTCTACCCCGGCGCCGGCGGCGAGGAGGAGATTGGCAGCAGCGGACGCGCGCGAGCAATCGCCCTCCCTCCAC
CCGGGCGCGAGGAAGAGGAAGCGAGGCGGCGCAGCGGCAGGGGCGCCGAGGCTGCGCCCGGCGGAGGAGCAGGTC
TTCAGCGGCCTCGCCTTCTTCTACGTCCCGAACAACGACATCGCGCCGGCCAGGCGGCTCCGCATCGGCAAGGCC
AGGGAGTACGGCGCGGCGTGGACGCGGAGCTACGCCGGCGCGACGCACATCGTCGTCGACAAGAACCTCGACTAC
GCCGACGTCGCCAAGGTCGTGCCCGTCGCCGCCCTGGCCCGCGGGGGCCCGAAGCTGGTCAACGAGGACTACCCG
ATCGACTGCATACAGTTCCGCTCCCTGCTCGACCACGGCCAGAAAAAGTACCGGGTCGCCGGCCAGCCGGCCGTC
GCCGGAGACGATGCTGTCTCGGGCCCGCCGCAAGCGCCGGAGAGCCCCGACGACGGGAAGCGACGGGATCCTGCG
CCTCCCCCGCCGGGCACGCCCCAGAGGAGCGACGAGCCCCCTTCCCAAGCGAGCGTCGTGGACGCAACGCCGCTT
CCCGCGGGTCCGCAGCCCCGAAGCACCGGCGCGACGGCTCGCCCGCGGCGGGAGTCGCCGGGGGGGGCCGAGGAC
GAGCTGTCGGGCTTCATCTCCATGATGCAGGAGTTTCGGCATCTGCCGCTCGACAACGACGACGACGAGCTCGCG
GGGTCCGAACCCGAACGGGCCGAGACGAGGGAAGACGAGGACGATGTCGCTGCCTCGGAGTCGGAATCGGAATCG
GCTCGCGACGGCGGCGGCAGGAAGAAGGCGCAGGCGAAGAGCAGACGGAAAGGCGGCCGATTCGAGGACCGGTTC
GCCTGCCACCACGCCGGCGAGCAGGCGGCGCTGGCGGAGAACGCCAACGCGCGCACGGTGGAGGTGCTCCAGAGC
ATGGCCGACTTCTACGAGCGGGTGGGCGACGAGTGGAGGACGCTGGGGTACCGCAAGGCCATCACGACGCTGAAG
CGGCAGAGGGTCAGGATCCGCAGCGAGGAGGAGGCGGCGCGGCTGCCGCACATCGGGCGGCGGATCGCGCAGAAG
ATTGAGGAGATTGTGACGACGGACCGGCTGCGGCGGCTCGAGTACGCGCGCGAGGAGGCGACGGACGGAGCGCTC
CAGCTCTTCCTGCAGGTCTACGGCGTCGGCAGCAGGCAGGCCCGGCAGTGGGTGGCGCAGGGGTACCGCAGCCTC
GACGAGCTGAGGAAGGGCGGCGTCAGGCTGACGGCCAGCCAGGCGATCGGGGTCGAGCACTTCGACGACCTGCAG
CAGGCGATCCCGCGGCGCGAGGTGGAGGCGCTCGGGGCGGTGGTGCGGCGCGCGGCGGCGCGGCTCGACCCGGCC
GTCGAGCTCATCGTCGGCGGCAGCTACCGCCGGGGCGCCGAGAGCTCGCGCGACATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail