Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10842
Gene name
LocationContig_911:10301..10833
Strand-
Gene length (bp)532
Transcript length (bp)441
Coding sequence length (bp)441
Protein length (aa) 147

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 6.8E-07 35 77

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q562C4|MET7B_RAT Methyltransferase-like protein 7B OS=Rattus norvegicus GN=Mettl7b PE=1 SV=1 33 146 1.0E-10
sp|Q9DD20|MET7B_MOUSE Methyltransferase-like protein 7B OS=Mus musculus GN=Mettl7b PE=1 SV=2 33 146 2.0E-09
sp|Q6UX53|MET7B_HUMAN Methyltransferase-like protein 7B OS=Homo sapiens GN=METTL7B PE=1 SV=2 33 146 6.0E-09
sp|Q9H8H3|MET7A_HUMAN Methyltransferase-like protein 7A OS=Homo sapiens GN=METTL7A PE=1 SV=1 33 146 2.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10842
LRQRVRDVGLGEVYEVVPVGIESVGDPAAWAGQIPPGSVDCIVGILCLCSIPDPDENIRRLYKLLKPGGRWYVYE
HVEATRGGPLLSLYQRFVSIPWAFFIGSCRICRPTGKRLRDAGPWQAVDLTQPPDEPPYQVLPHILGTLTK*
Coding >Hirsu2|10842
CTGAGGCAGCGCGTCCGCGACGTCGGCCTCGGCGAAGTCTACGAGGTCGTCCCCGTCGGCATCGAGTCCGTCGGC
GACCCGGCCGCCTGGGCCGGCCAGATCCCCCCGGGCTCCGTCGACTGCATCGTCGGCATCCTGTGCCTCTGCAGC
ATCCCGGATCCGGACGAGAACATCCGGCGCCTTTACAAGCTGCTCAAGCCGGGAGGTCGCTGGTACGTCTATGAG
CACGTCGAGGCGACCCGCGGCGGGCCGCTGCTCAGCCTCTATCAGCGCTTCGTCAGCATTCCCTGGGCCTTTTTC
ATCGGCTCGTGTCGCATCTGCCGCCCCACGGGAAAGAGACTTCGGGACGCCGGCCCGTGGCAGGCTGTCGACCTG
ACGCAGCCGCCGGACGAGCCGCCGTACCAGGTCCTGCCTCATATTCTCGGGACACTGACCAAGTAG
Transcript >Hirsu2|10842
CTGAGGCAGCGCGTCCGCGACGTCGGCCTCGGCGAAGTCTACGAGGTCGTCCCCGTCGGCATCGAGTCCGTCGGC
GACCCGGCCGCCTGGGCCGGCCAGATCCCCCCGGGCTCCGTCGACTGCATCGTCGGCATCCTGTGCCTCTGCAGC
ATCCCGGATCCGGACGAGAACATCCGGCGCCTTTACAAGCTGCTCAAGCCGGGAGGTCGCTGGTACGTCTATGAG
CACGTCGAGGCGACCCGCGGCGGGCCGCTGCTCAGCCTCTATCAGCGCTTCGTCAGCATTCCCTGGGCCTTTTTC
ATCGGCTCGTGTCGCATCTGCCGCCCCACGGGAAAGAGACTTCGGGACGCCGGCCCGTGGCAGGCTGTCGACCTG
ACGCAGCCGCCGGACGAGCCGCCGTACCAGGTCCTGCCTCATATTCTCGGGACACTGACCAAGTAG
Gene >Hirsu2|10842
CTGAGGCAGCGCGTCCGCGACGTCGGCCTCGGCGAAGTCTACGAGGTCGTCCCCGTCGGCATCGAGTCCGTCGGC
GACCCGGCCGCCTGGGCCGGCCAGATCCCCCCGGGCTCCGTCGACTGCATCGTCGGCATCCTGTGCCTCTGCAGC
ATCCCGGATCCGGACGAGAACATCCGGCGCCTTTACAAGCTGCTCAAGCCGGGAGGTCGCTGGTACGTCTATGAG
CACGTCGAGGCGACCCGCGGCGGGCCGCTGCTCAGCCTCTATCAGCGTAAGTCGCGTTTTCCCCGCTGCTGCTGC
TGCTGCCCACCTGATCGTCACCGCTCATCGTCCCGCCCTTCTCTCTCTCCCTCTCTCTGTAGGCTTCGTCAGCAT
TCCCTGGGCCTTTTTCATCGGCTCGTGTCGCATCTGCCGCCCCACGGGAAAGAGACTTCGGGACGCCGGCCCGTG
GCAGGCTGTCGACCTGACGCAGCCGCCGGACGAGCCGCCGTACCAGGTCCTGCCTCATATTCTCGGGACACTGAC
CAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail