Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10837
Gene name
LocationContig_910:2651..6860
Strand-
Gene length (bp)4209
Transcript length (bp)4149
Coding sequence length (bp)4149
Protein length (aa) 1383

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 2.7E-22 107 257
PF00005 ABC_tran ABC transporter 3.6E-24 736 894
PF01061 ABC2_membrane ABC-2 type transporter 2.5E-26 401 613
PF01061 ABC2_membrane ABC-2 type transporter 2.6E-20 1098 1297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 105 1367 0.0E+00
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 101 1368 2.0E-121
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 106 1368 7.0E-105
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 100 1292 2.0E-92
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 51 1310 8.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 105 1367 0.0E+00
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 101 1368 2.0E-121
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 106 1368 7.0E-105
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 100 1292 2.0E-92
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 51 1310 8.0E-90
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 101 1310 1.0E-88
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 103 1369 4.0E-87
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 105 1268 6.0E-86
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 103 977 1.0E-84
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 105 1317 5.0E-84
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 56 1002 1.0E-83
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 103 977 6.0E-83
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 106 1002 1.0E-82
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 103 1310 1.0E-82
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 106 978 1.0E-82
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 106 677 4.0E-82
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 101 979 5.0E-82
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 93 981 1.0E-81
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 93 981 1.0E-81
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 106 1297 7.0E-81
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 102 1002 3.0E-80
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 102 1002 8.0E-80
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 102 978 1.0E-79
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 106 1002 2.0E-79
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 102 977 2.0E-79
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 106 978 2.0E-79
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 98 1002 6.0E-79
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 106 1002 8.0E-79
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 106 978 1.0E-78
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 105 985 1.0E-78
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 105 1002 2.0E-78
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 102 1002 3.0E-78
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 105 1309 3.0E-78
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 87 1225 7.0E-78
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 103 1032 7.0E-78
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 50 980 3.0E-77
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 97 676 8.0E-77
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 106 1002 2.0E-76
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 104 676 2.0E-76
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 114 1313 6.0E-76
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 97 985 9.0E-76
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 105 978 1.0E-75
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 102 1002 1.0E-75
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 106 978 2.0E-75
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 100 980 2.0E-75
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 104 631 3.0E-75
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 104 676 3.0E-75
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 102 627 5.0E-75
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 102 1002 7.0E-75
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 104 676 8.0E-75
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 102 1238 2.0E-74
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 106 984 2.0E-74
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 97 985 2.0E-74
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 104 676 4.0E-74
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 94 981 3.0E-73
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 104 672 7.0E-73
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 97 650 1.0E-72
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 106 991 3.0E-72
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 106 986 6.0E-72
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 101 1311 8.0E-72
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 18 621 9.0E-72
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 106 1002 2.0E-71
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 105 1002 2.0E-70
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 117 618 3.0E-70
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 105 1002 1.0E-69
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 104 1219 2.0E-69
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 69 979 3.0E-69
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 17 618 4.0E-69
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 105 1297 4.0E-69
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 105 986 7.0E-69
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 50 1002 1.0E-68
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 56 980 2.0E-68
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 711 1364 2.0E-68
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 102 978 4.0E-68
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 105 676 5.0E-68
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 97 614 5.0E-68
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 717 1330 9.0E-68
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 99 1001 1.0E-67
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 728 1330 2.0E-67
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 733 1330 2.0E-67
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 728 1364 2.0E-67
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 733 1330 3.0E-67
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 100 620 4.0E-67
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 686 1364 3.0E-66
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 101 667 4.0E-66
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 731 1369 1.0E-65
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 102 1002 1.0E-65
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 104 613 2.0E-65
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 104 613 2.0E-65
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 59 615 3.0E-65
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 99 643 5.0E-65
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 728 1364 1.0E-64
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 731 1369 2.0E-64
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 716 1369 2.0E-64
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 105 676 5.0E-64
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 731 1369 7.0E-64
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 104 614 7.0E-64
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 104 613 1.0E-63
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 100 674 3.0E-63
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 87 613 3.0E-63
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 728 1272 4.0E-63
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 728 1364 7.0E-63
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 102 645 9.0E-63
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 718 1319 2.0E-62
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 104 613 2.0E-62
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 690 1364 3.0E-62
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 729 1366 1.0E-61
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 104 663 1.0E-61
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 103 663 2.0E-61
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 733 1297 2.0E-61
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 733 1297 2.0E-61
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 105 674 2.0E-61
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 99 626 4.0E-61
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 60 605 4.0E-61
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 740 1266 5.0E-61
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 104 979 5.0E-61
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 731 1297 5.0E-61
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 740 1266 6.0E-61
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 735 984 8.0E-61
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 59 665 9.0E-61
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 95 667 1.0E-60
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 740 1262 2.0E-60
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 45 613 2.0E-60
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 733 1297 5.0E-60
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 50 613 9.0E-60
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 60 605 9.0E-60
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 733 1241 1.0E-59
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 104 663 2.0E-59
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 688 1311 2.0E-59
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 102 674 4.0E-59
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 731 1362 5.0E-59
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 717 1274 7.0E-59
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 100 613 7.0E-59
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 102 614 7.0E-59
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 100 645 8.0E-59
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 717 1274 9.0E-59
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 45 613 3.0E-58
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 11 605 3.0E-58
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 104 618 3.0E-58
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 690 1217 6.0E-58
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 711 1201 1.0E-57
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 104 674 2.0E-57
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 85 613 2.0E-57
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 729 1198 5.0E-57
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 107 1302 7.0E-57
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 105 622 7.0E-57
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 397 978 9.0E-57
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 733 1362 2.0E-55
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 96 648 2.0E-55
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 77 673 5.0E-55
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 104 664 1.0E-54
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 733 1335 2.0E-54
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 726 1371 5.0E-53
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 58 672 8.0E-53
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 106 341 1.0E-52
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 731 1362 3.0E-52
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 101 634 5.0E-52
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 733 1378 9.0E-52
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 106 672 1.0E-51
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 724 1329 2.0E-51
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 101 634 2.0E-51
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 59 676 2.0E-51
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 751 1361 3.0E-51
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 106 676 3.0E-51
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 733 980 4.0E-51
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 106 676 7.0E-51
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 106 676 7.0E-51
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 89 671 8.0E-51
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 11 607 1.0E-50
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 733 1228 1.0E-50
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 96 672 1.0E-50
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 12 607 1.0E-50
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 732 997 2.0E-50
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 5 676 2.0E-50
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 101 645 3.0E-50
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 106 672 1.0E-49
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 100 678 1.0E-49
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 96 672 1.0E-49
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 106 620 1.0E-49
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 104 372 1.0E-49
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 106 598 1.0E-49
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 13 603 2.0E-49
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 100 678 2.0E-49
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 706 978 3.0E-49
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 99 639 3.0E-49
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 106 603 6.0E-49
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 99 644 7.0E-49
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 101 634 2.0E-48
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 58 676 3.0E-48
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 106 597 3.0E-48
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 58 634 5.0E-48
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 98 979 7.0E-48
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 7 608 7.0E-48
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 106 664 9.0E-48
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 101 676 1.0E-47
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 101 668 1.0E-47
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 100 613 2.0E-47
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 58 665 2.0E-47
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 106 664 5.0E-47
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 106 667 6.0E-47
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 73 601 7.0E-47
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 101 341 8.0E-47
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 11 650 9.0E-47
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 101 639 1.0E-46
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 59 667 1.0E-46
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 104 648 2.0E-46
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 732 1248 2.0E-46
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 733 1042 3.0E-46
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 59 607 3.0E-46
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 87 634 4.0E-46
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 13 676 5.0E-46
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 734 1018 5.0E-46
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 58 660 5.0E-46
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 102 327 6.0E-46
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 59 672 8.0E-46
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 106 672 9.0E-46
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 104 595 1.0E-45
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 167 1369 2.0E-45
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 84 639 2.0E-45
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 101 600 5.0E-45
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 106 598 6.0E-45
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 58 676 6.0E-45
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 106 664 6.0E-45
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 95 342 7.0E-45
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 30 670 7.0E-45
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 101 603 1.0E-44
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 106 613 1.0E-44
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 711 1328 2.0E-44
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 104 341 6.0E-44
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 59 667 8.0E-44
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 728 1361 8.0E-44
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 101 613 1.0E-43
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 59 603 1.0E-43
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 734 1018 2.0E-43
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 685 1328 2.0E-43
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 101 613 2.0E-43
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 104 639 2.0E-43
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 58 667 3.0E-43
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 106 667 5.0E-43
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 59 667 1.0E-42
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 41 676 2.0E-42
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 717 980 2.0E-42
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 100 674 4.0E-42
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 107 634 4.0E-42
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 104 603 8.0E-42
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 99 342 1.0E-41
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 728 1321 6.0E-41
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 748 1366 9.0E-41
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 734 1007 2.0E-40
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 97 351 2.0E-40
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 493 977 2.0E-40
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 104 648 3.0E-40
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 713 1006 4.0E-40
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 728 978 9.0E-40
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 726 1364 1.0E-39
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 116 640 1.0E-39
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 704 1001 4.0E-39
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 96 672 5.0E-39
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 727 1211 7.0E-39
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 733 1045 7.0E-39
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 728 1322 2.0E-38
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 101 341 2.0E-38
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 104 639 4.0E-38
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 729 979 1.0E-37
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 114 639 1.0E-37
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 714 979 1.0E-37
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 724 1361 1.0E-37
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 101 436 2.0E-37
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 729 1008 2.0E-37
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 104 589 2.0E-37
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 103 343 1.0E-36
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 104 639 1.0E-36
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 728 978 8.0E-35
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 716 979 8.0E-35
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 102 627 9.0E-35
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 102 640 4.0E-34
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 732 1010 9.0E-34
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 735 1324 1.0E-33
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 732 1008 3.0E-33
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 733 978 2.0E-32
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 103 648 2.0E-32
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 735 1293 2.0E-32
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 692 1327 4.0E-32
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 104 639 4.0E-32
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 732 979 6.0E-32
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 732 985 7.0E-32
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 735 979 1.0E-31
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 731 1318 2.0E-31
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 735 1315 2.0E-30
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 732 1248 2.0E-30
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 731 1298 6.0E-30
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 687 1293 7.0E-30
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 101 615 9.0E-30
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 729 1234 1.0E-29
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 692 1327 2.0E-29
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 728 1311 2.0E-29
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 723 1315 4.0E-29
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 731 1011 5.0E-29
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 85 322 9.0E-29
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 723 1319 1.0E-28
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 725 1355 4.0E-28
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 105 343 4.0E-28
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 720 994 6.0E-28
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 725 1293 9.0E-28
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 723 989 3.0E-27
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 683 1318 5.0E-27
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 719 1241 6.0E-27
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 725 989 7.0E-27
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 728 989 1.0E-26
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 723 1355 1.0E-26
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 720 993 2.0E-26
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 695 1311 4.0E-26
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 735 1328 4.0E-26
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 729 1356 5.0E-26
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 725 989 5.0E-26
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 735 1007 5.0E-26
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 734 1031 6.0E-26
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 717 1311 6.0E-26
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 729 1298 9.0E-26
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 725 1308 1.0E-25
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 735 1329 1.0E-25
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 728 974 3.0E-25
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 695 1311 5.0E-25
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 720 954 5.0E-25
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 723 989 6.0E-25
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 727 974 6.0E-25
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 735 1330 2.0E-24
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 735 1330 2.0E-24
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 725 992 4.0E-24
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 735 1060 5.0E-24
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 106 325 8.0E-24
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 688 1018 1.0E-23
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 735 1311 1.0E-23
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 730 1307 3.0E-23
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 735 1061 8.0E-23
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 721 1031 9.0E-23
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 73 292 3.0E-22
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 735 928 6.0E-22
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 73 292 8.0E-22
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 729 989 1.0E-21
sp|Q2W1R8|MODC_MAGSA Molybdenum import ATP-binding protein ModC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=modC PE=3 SV=1 116 314 2.0E-21
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 735 916 1.0E-20
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 722 923 1.0E-19
sp|Q2RWI9|MODC_RHORT Molybdenum import ATP-binding protein ModC OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=modC PE=3 SV=1 119 317 2.0E-19
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 725 942 3.0E-19
sp|Q1IGZ0|METN2_PSEE4 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas entomophila (strain L48) GN=metN2 PE=3 SV=1 725 1057 6.0E-19
sp|Q9X1Z1|ECFA1_THEMA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ecfA1 PE=1 SV=1 735 924 2.0E-18
sp|Q88RL5|METN1_PSEPK Methionine import ATP-binding protein MetN 1 OS=Pseudomonas putida (strain KT2440) GN=metN1 PE=3 SV=1 725 987 2.0E-18
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 398 674 3.0E-18
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 735 942 3.0E-18
sp|Q3KK97|METN1_PSEPF Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=metN1 PE=3 SV=1 725 987 4.0E-18
sp|A0KMJ3|MACB2_AERHH Macrolide export ATP-binding/permease protein MacB 2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=macB2 PE=3 SV=1 720 952 1.0E-17
sp|Q87UN4|METN2_PSESM Methionine import ATP-binding protein MetN 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metN2 PE=3 SV=1 725 987 1.0E-17
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 104 315 2.0E-17
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 730 985 2.0E-17
sp|Q9HT70|METN2_PSEAE Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN2 PE=3 SV=1 725 1058 2.0E-17
sp|Q02DK6|METN2_PSEAB Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN2 PE=3 SV=1 725 1058 2.0E-17
sp|Q48PU6|METN1_PSE14 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metN1 PE=3 SV=1 725 987 2.0E-17
sp|Q4KKK8|METN1_PSEF5 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metN1 PE=3 SV=1 725 1058 5.0E-17
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 104 311 5.0E-17
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 735 924 6.0E-17
sp|Q04FM1|ECFA2_OENOB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA2 PE=3 SV=1 736 977 7.0E-17
sp|Q4ZZR8|METN1_PSEU2 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metN1 PE=3 SV=1 725 987 7.0E-17
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 732 957 7.0E-17
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 99 310 8.0E-17
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 88 346 9.0E-17
sp|P97027|SSUB_BACSU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus subtilis (strain 168) GN=ssuB PE=1 SV=4 101 303 1.0E-16
sp|O31711|YKNY_BACSU Uncharacterized ABC transporter ATP-binding protein YknY OS=Bacillus subtilis (strain 168) GN=yknY PE=1 SV=1 735 924 1.0E-16
sp|Q8EAN3|MODC_SHEON Molybdenum import ATP-binding protein ModC OS=Shewanella oneidensis (strain MR-1) GN=modC PE=3 SV=1 110 320 1.0E-16
sp|Q8X5I6|TAUB_ECO57 Taurine import ATP-binding protein TauB OS=Escherichia coli O157:H7 GN=tauB PE=3 SV=1 733 938 1.0E-16
sp|O07016|YVFR_BACSU Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1 728 923 1.0E-16
sp|Q8T5Z7|ABCA1_DICDI ABC transporter A family member 1 OS=Dictyostelium discoideum GN=abcA1 PE=2 SV=1 100 306 1.0E-16
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 735 976 1.0E-16
sp|Q325N3|TAUB_SHIBS Taurine import ATP-binding protein TauB OS=Shigella boydii serotype 4 (strain Sb227) GN=tauB PE=3 SV=1 733 938 2.0E-16
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 104 315 2.0E-16
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 104 315 2.0E-16
sp|Q0K2U3|TAUB_CUPNH Taurine import ATP-binding protein TauB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tauB PE=3 SV=1 736 930 2.0E-16
sp|Q82VK1|MACB_NITEU Macrolide export ATP-binding/permease protein MacB OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=macB PE=3 SV=1 722 923 2.0E-16
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 104 315 2.0E-16
sp|Q98KI3|MODC_RHILO Molybdenum import ATP-binding protein ModC OS=Rhizobium loti (strain MAFF303099) GN=modC PE=3 SV=1 117 313 2.0E-16
sp|Q7UX73|LOLD1_RHOBA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lolD1 PE=3 SV=1 734 927 3.0E-16
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 735 965 3.0E-16
sp|Q8FKF5|TAUB_ECOL6 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tauB PE=3 SV=1 733 938 3.0E-16
sp|Q58206|Y796_METJA Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1 736 923 3.0E-16
sp|Q21GS5|MODC_SACD2 Molybdenum import ATP-binding protein ModC OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=modC PE=3 SV=1 739 947 3.0E-16
sp|Q3SJC6|MODC_THIDA Molybdenum import ATP-binding protein ModC OS=Thiobacillus denitrificans (strain ATCC 25259) GN=modC PE=3 SV=1 109 342 3.0E-16
sp|Q0HFA0|MODC_SHESM Molybdenum import ATP-binding protein ModC OS=Shewanella sp. (strain MR-4) GN=modC PE=3 SV=1 110 314 4.0E-16
sp|Q471U2|TAUB_CUPPJ Taurine import ATP-binding protein TauB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tauB PE=3 SV=1 718 930 4.0E-16
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 728 924 4.0E-16
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 736 974 4.0E-16
sp|Q88F88|MACB_PSEPK Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas putida (strain KT2440) GN=macB PE=3 SV=1 722 923 4.0E-16
sp|Q3Z542|TAUB_SHISS Taurine import ATP-binding protein TauB OS=Shigella sonnei (strain Ss046) GN=tauB PE=3 SV=1 733 938 4.0E-16
sp|Q47538|TAUB_ECOLI Taurine import ATP-binding protein TauB OS=Escherichia coli (strain K12) GN=tauB PE=2 SV=1 733 938 4.0E-16
sp|Q8RQL7|GLUA_COREF Glutamate transport ATP-binding protein GluA OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gluA PE=3 SV=1 736 924 5.0E-16
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 735 924 5.0E-16
sp|O34677|GLNQ_BACSU Glutamine transport ATP-binding protein GlnQ OS=Bacillus subtilis (strain 168) GN=glnQ PE=2 SV=1 735 924 5.0E-16
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 99 302 5.0E-16
sp|Q48C94|TAUB_PSE14 Taurine import ATP-binding protein TauB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tauB PE=3 SV=1 735 908 7.0E-16
sp|Q1RFH8|TAUB_ECOUT Taurine import ATP-binding protein TauB OS=Escherichia coli (strain UTI89 / UPEC) GN=tauB PE=3 SV=1 733 938 7.0E-16
sp|Q0TKS1|TAUB_ECOL5 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tauB PE=3 SV=1 733 938 7.0E-16
sp|Q32IZ6|TAUB_SHIDS Taurine import ATP-binding protein TauB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tauB PE=3 SV=1 733 938 8.0E-16
sp|Q0HYN8|MODC_SHESR Molybdenum import ATP-binding protein ModC OS=Shewanella sp. (strain MR-7) GN=modC PE=3 SV=1 110 314 9.0E-16
sp|Q03AH0|POTA_LACC3 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus casei (strain ATCC 334) GN=potA PE=3 SV=1 727 929 9.0E-16
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 723 923 1.0E-15
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 104 289 1.0E-15
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 104 289 1.0E-15
sp|Q8UKE4|MACB_AGRFC Macrolide export ATP-binding/permease protein MacB OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=macB PE=3 SV=1 735 926 1.0E-15
sp|Q5HQ70|POTA_STAEQ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=potA PE=3 SV=1 735 929 1.0E-15
sp|Q664P8|TAUB_YERPS Taurine import ATP-binding protein TauB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tauB PE=3 SV=1 733 930 1.0E-15
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 728 923 1.0E-15
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 104 316 1.0E-15
sp|Q1IGM2|TAUB_PSEE4 Taurine import ATP-binding protein TauB OS=Pseudomonas entomophila (strain L48) GN=tauB PE=3 SV=1 735 908 1.0E-15
sp|Q89EW7|MODC2_BRADU Molybdenum import ATP-binding protein ModC 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=modC2 PE=3 SV=1 96 314 1.0E-15
sp|Q87UH7|TAUB_PSESM Taurine import ATP-binding protein TauB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tauB PE=3 SV=1 735 908 1.0E-15
sp|Q8KZR4|TAUB_PSEPU Taurine import ATP-binding protein TauB OS=Pseudomonas putida GN=tauB PE=3 SV=1 735 908 1.0E-15
sp|Q92NU9|MACB_RHIME Macrolide export ATP-binding/permease protein MacB OS=Rhizobium meliloti (strain 1021) GN=macB PE=3 SV=1 106 327 2.0E-15
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 107 306 2.0E-15
sp|Q1CCR9|TAUB_YERPN Taurine import ATP-binding protein TauB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tauB PE=3 SV=1 733 930 2.0E-15
sp|Q8ZJD0|TAUB_YERPE Taurine import ATP-binding protein TauB OS=Yersinia pestis GN=tauB PE=3 SV=1 733 930 2.0E-15
sp|Q1C2S1|TAUB_YERPA Taurine import ATP-binding protein TauB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tauB PE=3 SV=1 733 930 2.0E-15
sp|Q7NUJ3|MACB_CHRVO Macrolide export ATP-binding/permease protein MacB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=macB PE=3 SV=1 106 308 2.0E-15
sp|Q03PF2|POTA_LACBA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1 728 929 2.0E-15
sp|P39456|TCYC_BACSU L-cystine import ATP-binding protein TcyC OS=Bacillus subtilis (strain 168) GN=tcyC PE=1 SV=4 728 955 2.0E-15
sp|Q9KLL9|MODC_VIBCH Molybdenum import ATP-binding protein ModC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=modC PE=3 SV=1 104 320 2.0E-15
sp|Q1QDA8|MACB_PSYCK Macrolide export ATP-binding/permease protein MacB OS=Psychrobacter cryohalolentis (strain K5) GN=macB PE=3 SV=1 735 923 2.0E-15
sp|Q9CM47|MACB_PASMU Macrolide export ATP-binding/permease protein MacB OS=Pasteurella multocida (strain Pm70) GN=macB PE=3 SV=1 734 955 2.0E-15
sp|Q7CJG3|MACB2_YERPE Macrolide export ATP-binding/permease protein MacB 2 OS=Yersinia pestis GN=macB2 PE=3 SV=1 725 923 2.0E-15
sp|Q1C5W7|MACB2_YERPA Macrolide export ATP-binding/permease protein MacB 2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=macB2 PE=3 SV=1 725 923 2.0E-15
sp|Q1CJW8|MACB1_YERPN Macrolide export ATP-binding/permease protein MacB 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=macB1 PE=3 SV=1 725 923 2.0E-15
sp|Q8U4L3|Y068_PYRFU Putative ABC transporter ATP-binding protein PF0068 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0068 PE=3 SV=1 733 967 2.0E-15
sp|Q668L6|MACB2_YERPS Macrolide export ATP-binding/permease protein MacB 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=macB2 PE=3 SV=1 725 923 2.0E-15
sp|Q7CN92|POTA_STRP8 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1 735 929 2.0E-15
sp|Q99ZS8|POTA_STRP1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1 735 929 2.0E-15
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 735 929 2.0E-15
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 735 929 2.0E-15
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 735 929 2.0E-15
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 735 929 2.0E-15
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 735 929 2.0E-15
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 735 929 2.0E-15
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 735 929 2.0E-15
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 735 929 2.0E-15
sp|Q65TH4|MACB_MANSM Macrolide export ATP-binding/permease protein MacB OS=Mannheimia succiniciproducens (strain MBEL55E) GN=macB PE=3 SV=1 735 923 2.0E-15
sp|A1U0A9|MACB_MARHV Macrolide export ATP-binding/permease protein MacB OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=macB PE=3 SV=1 106 289 2.0E-15
sp|Q8CUY0|PHNC2_OCEIH Phosphonates import ATP-binding protein PhnC 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=phnC2 PE=3 SV=1 735 951 3.0E-15
sp|Q88G95|MODC_PSEPK Molybdenum import ATP-binding protein ModC OS=Pseudomonas putida (strain KT2440) GN=modC PE=3 SV=1 110 314 3.0E-15
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 104 312 3.0E-15
sp|Q98DW6|TAUB_RHILO Taurine import ATP-binding protein TauB OS=Rhizobium loti (strain MAFF303099) GN=tauB PE=3 SV=1 101 306 3.0E-15
sp|Q399M3|MACB_BURL3 Macrolide export ATP-binding/permease protein MacB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=macB PE=3 SV=1 735 946 3.0E-15
sp|Q3KJQ7|TAUB_PSEPF Taurine import ATP-binding protein TauB OS=Pseudomonas fluorescens (strain Pf0-1) GN=tauB PE=3 SV=1 733 908 3.0E-15
sp|Q6D7D0|MODC_PECAS Molybdenum import ATP-binding protein ModC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=modC PE=3 SV=1 110 321 3.0E-15
sp|Q4L8L7|HRTA_STAHJ Putative hemin import ATP-binding protein HrtA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hrtA PE=3 SV=1 735 942 3.0E-15
sp|Q8TIW9|Y4021_METAC Putative ABC transporter ATP-binding protein MA_4021 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4021 PE=3 SV=1 720 923 3.0E-15
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 107 316 3.0E-15
sp|Q4FU75|MACB_PSYA2 Macrolide export ATP-binding/permease protein MacB OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=macB PE=3 SV=1 735 923 3.0E-15
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 104 312 3.0E-15
sp|Q1CFP9|MODC_YERPN Molybdenum import ATP-binding protein ModC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=modC PE=3 SV=1 109 306 4.0E-15
sp|Q8ZGX6|MODC_YERPE Molybdenum import ATP-binding protein ModC OS=Yersinia pestis GN=modC PE=3 SV=1 109 306 4.0E-15
sp|Q1C951|MODC_YERPA Molybdenum import ATP-binding protein ModC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=modC PE=3 SV=1 109 306 4.0E-15
sp|Q83MA0|TAUB_SHIFL Taurine import ATP-binding protein TauB OS=Shigella flexneri GN=tauB PE=3 SV=1 733 938 4.0E-15
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 732 924 4.0E-15
sp|Q66D71|MODC_YERPS Molybdenum import ATP-binding protein ModC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=modC PE=3 SV=1 109 306 4.0E-15
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 107 287 4.0E-15
sp|Q2EHL8|MACB_AGGAC Macrolide export ATP-binding/permease protein MacB OS=Aggregatibacter actinomycetemcomitans GN=macB PE=1 SV=2 727 923 5.0E-15
sp|Q5MZ53|CMPD_SYNP6 Bicarbonate transport ATP-binding protein CmpD OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cmpD PE=3 SV=1 100 306 5.0E-15
sp|Q55108|CMPD_SYNE7 Bicarbonate transport ATP-binding protein CmpD OS=Synechococcus elongatus (strain PCC 7942) GN=cmpD PE=1 SV=1 100 306 5.0E-15
sp|A3PRY1|UGPC_RHOS1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ugpC PE=3 SV=1 106 306 5.0E-15
sp|Q88RA1|TAUB_PSEPK Taurine import ATP-binding protein TauB OS=Pseudomonas putida (strain KT2440) GN=tauB PE=3 SV=1 735 908 6.0E-15
sp|P15031|FECE_ECOLI Fe(3+) dicitrate transport ATP-binding protein FecE OS=Escherichia coli (strain K12) GN=fecE PE=2 SV=1 103 334 6.0E-15
sp|A1U0A9|MACB_MARHV Macrolide export ATP-binding/permease protein MacB OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=macB PE=3 SV=1 735 923 7.0E-15
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 107 319 7.0E-15
sp|Q8D740|MODC_VIBVU Molybdenum import ATP-binding protein ModC OS=Vibrio vulnificus (strain CMCP6) GN=modC PE=3 SV=1 110 320 7.0E-15
sp|Q9I190|MACB_PSEAE Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=macB PE=3 SV=1 722 923 7.0E-15
sp|Q02MI4|MACB_PSEAB Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=macB PE=3 SV=1 722 923 7.0E-15
sp|Q8CPN0|POTA_STAES Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=potA PE=3 SV=1 735 929 7.0E-15
sp|Q6FYL0|MACB_BARQU Macrolide export ATP-binding/permease protein MacB OS=Bartonella quintana (strain Toulouse) GN=macB PE=3 SV=1 734 923 7.0E-15
sp|P0AAF9|ARTP_SHIFL Arginine transport ATP-binding protein ArtP OS=Shigella flexneri GN=artP PE=3 SV=1 750 958 7.0E-15
sp|P0AAF6|ARTP_ECOLI Arginine transport ATP-binding protein ArtP OS=Escherichia coli (strain K12) GN=artP PE=1 SV=1 750 958 7.0E-15
sp|P0AAF7|ARTP_ECOL6 Arginine transport ATP-binding protein ArtP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=artP PE=3 SV=1 750 958 7.0E-15
sp|P0AAF8|ARTP_ECO57 Arginine transport ATP-binding protein ArtP OS=Escherichia coli O157:H7 GN=artP PE=3 SV=1 750 958 7.0E-15
sp|Q4KK16|TAUB_PSEF5 Taurine import ATP-binding protein TauB OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tauB PE=3 SV=1 733 908 8.0E-15
sp|Q8RD07|Y246_CALS4 Putative ABC transporter ATP-binding protein TTE0246 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE0246 PE=3 SV=1 751 923 8.0E-15
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 113 283 8.0E-15
sp|Q55BC0|ABCA8_DICDI ABC transporter A family member 8 OS=Dictyostelium discoideum GN=abcA8 PE=3 SV=1 100 312 8.0E-15
sp|Q6W2B1|TAUB_RHISN Taurine import ATP-binding protein TauB OS=Rhizobium sp. (strain NGR234) GN=tauB PE=3 SV=2 101 304 8.0E-15
sp|Q7ME63|MODC_VIBVY Molybdenum import ATP-binding protein ModC OS=Vibrio vulnificus (strain YJ016) GN=modC PE=3 SV=2 110 320 8.0E-15
sp|Q67JX4|ECFA2_SYMTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ecfA2 PE=3 SV=1 736 950 8.0E-15
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 107 287 8.0E-15
sp|Q55462|CMPC_SYNY3 Bicarbonate transport ATP-binding protein CmpC OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cmpC PE=2 SV=1 107 306 9.0E-15
sp|Q4FMG5|TAUB_PELUB Taurine import ATP-binding protein TauB OS=Pelagibacter ubique (strain HTCC1062) GN=tauB PE=3 SV=1 736 930 9.0E-15
sp|Q6W2B1|TAUB_RHISN Taurine import ATP-binding protein TauB OS=Rhizobium sp. (strain NGR234) GN=tauB PE=3 SV=2 733 925 9.0E-15
sp|Q39CJ6|TAUB_BURL3 Taurine import ATP-binding protein TauB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tauB PE=3 SV=1 731 930 1.0E-14
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 739 975 1.0E-14
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 103 306 1.0E-14
sp|Q6LHL2|MODC_PHOPR Molybdenum import ATP-binding protein ModC OS=Photobacterium profundum GN=modC PE=3 SV=1 113 306 1.0E-14
sp|Q5NHP2|LOLD_FRATT Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lolD PE=3 SV=1 718 926 1.0E-14
sp|Q2A4V5|LOLD_FRATH Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lolD PE=3 SV=1 718 926 1.0E-14
sp|Q14J44|LOLD_FRAT1 Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lolD PE=3 SV=1 718 926 1.0E-14
sp|Q88ZJ6|POTA_LACPL Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=potA PE=3 SV=1 735 929 1.0E-14
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 666 961 1.0E-14
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 728 909 1.0E-14
sp|Q98DW6|TAUB_RHILO Taurine import ATP-binding protein TauB OS=Rhizobium loti (strain MAFF303099) GN=tauB PE=3 SV=1 718 942 1.0E-14
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 102 306 2.0E-14
sp|Q2VZJ1|CCMA_MAGSA Cytochrome c biogenesis ATP-binding export protein CcmA OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=ccmA PE=3 SV=1 742 923 2.0E-14
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 735 923 2.0E-14
sp|Q3IX40|UGPC_RHOS4 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ugpC PE=3 SV=1 106 306 2.0E-14
sp|A0KAV6|TAUB_BURCH Taurine import ATP-binding protein TauB OS=Burkholderia cenocepacia (strain HI2424) GN=tauB PE=3 SV=1 731 930 2.0E-14
sp|Q1BT84|TAUB_BURCA Taurine import ATP-binding protein TauB OS=Burkholderia cenocepacia (strain AU 1054) GN=tauB PE=3 SV=1 731 930 2.0E-14
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 728 923 2.0E-14
sp|Q3SRG8|LOLD_NITWN Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lolD PE=3 SV=1 732 920 2.0E-14
sp|P07821|FHUC_ECOLI Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Escherichia coli (strain K12) GN=fhuC PE=1 SV=3 729 955 2.0E-14
sp|Q1CGD7|MACB2_YERPN Macrolide export ATP-binding/permease protein MacB 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=macB2 PE=3 SV=1 735 923 2.0E-14
sp|Q66CL2|MACB1_YERPS Macrolide export ATP-binding/permease protein MacB 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=macB1 PE=3 SV=1 735 923 2.0E-14
sp|Q7CHI2|MACB1_YERPE Macrolide export ATP-binding/permease protein MacB 1 OS=Yersinia pestis GN=macB1 PE=3 SV=1 735 923 2.0E-14
sp|Q1CA99|MACB1_YERPA Macrolide export ATP-binding/permease protein MacB 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=macB1 PE=3 SV=1 735 923 2.0E-14
sp|A0B212|MACB_BURCH Macrolide export ATP-binding/permease protein MacB OS=Burkholderia cenocepacia (strain HI2424) GN=macB PE=3 SV=1 735 946 2.0E-14
sp|Q217L2|MACB_RHOPB Macrolide export ATP-binding/permease protein MacB OS=Rhodopseudomonas palustris (strain BisB18) GN=macB PE=3 SV=1 736 925 2.0E-14
sp|P37732|MODC1_AZOVI Molybdenum import ATP-binding protein ModC 1 OS=Azotobacter vinelandii GN=modC1 PE=3 SV=2 114 317 2.0E-14
sp|Q87AL9|METN_XYLFT Methionine import ATP-binding protein MetN OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metN PE=3 SV=1 734 999 2.0E-14
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 728 950 2.0E-14
sp|Q0BN75|LOLD_FRATO Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=lolD PE=3 SV=1 718 926 2.0E-14
sp|Q1BPZ6|MACB_BURCA Macrolide export ATP-binding/permease protein MacB OS=Burkholderia cenocepacia (strain AU 1054) GN=macB PE=3 SV=2 735 946 2.0E-14
sp|Q65M64|SSUB_BACLD Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ssuB PE=3 SV=1 727 943 2.0E-14
sp|O57872|Y132_PYRHO Putative ABC transporter ATP-binding protein PH0132 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0132 PE=3 SV=1 733 955 2.0E-14
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 736 923 2.0E-14
sp|Q0T7M2|TAUB_SHIF8 Taurine import ATP-binding protein TauB OS=Shigella flexneri serotype 5b (strain 8401) GN=tauB PE=3 SV=1 733 938 2.0E-14
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 104 311 2.0E-14
sp|Q9K0N7|MACB_NEIMB Macrolide export ATP-binding/permease protein MacB OS=Neisseria meningitidis serogroup B (strain MC58) GN=macB PE=3 SV=1 97 289 2.0E-14
sp|Q5MK06|MACB_NEIGO Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae GN=macB PE=1 SV=1 97 289 2.0E-14
sp|Q52815|AAPP_RHIL3 General L-amino acid transport ATP-binding protein AapP OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=aapP PE=3 SV=1 735 968 2.0E-14
sp|P0C2H2|MACB_ECOLX Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli GN=macB PE=3 SV=1 102 309 2.0E-14
sp|P0C2H3|MACB2_ECOK1 Macrolide export ATP-binding/permease protein MacB 2 OS=Escherichia coli O1:K1 / APEC GN=macB2 PE=3 SV=1 102 309 2.0E-14
sp|A1K323|MACB_AZOSB Macrolide export ATP-binding/permease protein MacB OS=Azoarcus sp. (strain BH72) GN=macB PE=3 SV=1 735 923 2.0E-14
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 107 306 2.0E-14
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 728 924 2.0E-14
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 728 950 2.0E-14
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 732 957 2.0E-14
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 107 312 3.0E-14
sp|Q49WM4|POTA_STAS1 Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=potA PE=3 SV=1 720 929 3.0E-14
sp|Q5F6V6|MACB_NEIG1 Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=macB PE=3 SV=1 97 289 3.0E-14
sp|P45092|ARTP_HAEIN Arginine transport ATP-binding protein ArtP OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=artP PE=3 SV=1 739 958 3.0E-14
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 103 326 3.0E-14
sp|Q58967|Y1572_METJA Putative ABC transporter ATP-binding protein MJ1572 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572 PE=3 SV=1 729 923 3.0E-14
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 730 973 3.0E-14
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 107 306 3.0E-14
sp|Q2YZ26|HRTA_STAAB Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hrtA PE=3 SV=1 727 945 3.0E-14
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 89 287 3.0E-14
sp|Q5MZ53|CMPD_SYNP6 Bicarbonate transport ATP-binding protein CmpD OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cmpD PE=3 SV=1 712 988 3.0E-14
sp|Q55108|CMPD_SYNE7 Bicarbonate transport ATP-binding protein CmpD OS=Synechococcus elongatus (strain PCC 7942) GN=cmpD PE=1 SV=1 712 988 3.0E-14
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 105 306 4.0E-14
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 101 307 4.0E-14
sp|P46903|NATA_BACSU ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1 739 923 4.0E-14
sp|Q2KVS6|MACB_BORA1 Macrolide export ATP-binding/permease protein MacB OS=Bordetella avium (strain 197N) GN=macB PE=3 SV=2 735 972 4.0E-14
sp|P50332|NODI_RHIGA Nod factor export ATP-binding protein I OS=Rhizobium galegae GN=nodI PE=3 SV=1 102 313 4.0E-14
sp|Q3SQZ1|MACB_NITWN Macrolide export ATP-binding/permease protein MacB OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=macB PE=3 SV=1 736 926 4.0E-14
sp|Q3A558|LOLD_PELCD Lipoprotein-releasing system ATP-binding protein LolD OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lolD PE=3 SV=1 722 926 4.0E-14
sp|Q55463|CMPD_SYNY3 Bicarbonate transport ATP-binding protein CmpD OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cmpD PE=2 SV=1 95 306 4.0E-14
sp|Q668Q3|FBPC_YERPS Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fbpC PE=3 SV=1 106 316 4.0E-14
sp|Q1CJS9|FBPC_YERPN Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fbpC PE=3 SV=1 106 316 4.0E-14
sp|Q8ZCM2|FBPC_YERPE Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis GN=fbpC PE=3 SV=1 106 316 4.0E-14
sp|Q1C607|FBPC_YERPA Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fbpC PE=3 SV=1 106 316 4.0E-14
sp|Q6LX68|ECFA_METMP Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanococcus maripaludis (strain S2 / LL) GN=ecfA PE=3 SV=1 731 955 4.0E-14
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 105 306 4.0E-14
sp|Q83LR7|MACB_SHIFL Macrolide export ATP-binding/permease protein MacB OS=Shigella flexneri GN=macB PE=3 SV=1 735 923 4.0E-14
sp|Q88ZZ2|Y149_LACPL Putative ABC transporter ATP-binding protein lp_0149 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_0149 PE=3 SV=1 714 974 4.0E-14
sp|Q81C68|SSUB_BACCR Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ssuB PE=3 SV=1 103 304 5.0E-14
sp|Q8PY26|Y1038_METMA Putative ABC transporter ATP-binding protein MM_1038 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1038 PE=3 SV=2 734 998 5.0E-14
sp|P55662|Y4TH_RHISN Probable amino-acid ABC transporter ATP-binding protein y4tH OS=Rhizobium sp. (strain NGR234) GN=NGR_a01510 PE=3 SV=1 734 926 5.0E-14
sp|Q9WYI7|Y352_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0352 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0352 PE=3 SV=1 750 923 5.0E-14
sp|Q4K9A4|MACB2_PSEF5 Macrolide export ATP-binding/permease protein MacB 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=macB2 PE=3 SV=1 722 923 5.0E-14
sp|Q6D2F6|FBPC2_PECAS Fe(3+) ions import ATP-binding protein FbpC 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC2 PE=3 SV=1 728 909 5.0E-14
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 105 317 5.0E-14
sp|Q3ATR5|MACB_CHLCH Macrolide export ATP-binding/permease protein MacB OS=Chlorobium chlorochromatii (strain CaD3) GN=macB PE=3 SV=1 736 924 5.0E-14
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 101 307 5.0E-14
sp|Q8NV47|HRTA_STAAW Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain MW2) GN=hrtA PE=3 SV=1 727 945 5.0E-14
sp|Q6G6W1|HRTA_STAAS Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain MSSA476) GN=hrtA PE=3 SV=1 727 945 5.0E-14
sp|Q7A3X3|HRTA_STAAN Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain N315) GN=hrtA PE=3 SV=1 727 945 5.0E-14
sp|Q99RR8|HRTA_STAAM Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hrtA PE=2 SV=1 727 945 5.0E-14
sp|A6QJK1|HRTA_STAAE Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain Newman) GN=hrtA PE=2 SV=1 727 945 5.0E-14
sp|Q5HDJ6|HRTA_STAAC Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain COL) GN=hrtA PE=3 SV=1 727 945 5.0E-14
sp|Q2FVR1|HRTA_STAA8 Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain NCTC 8325) GN=hrtA PE=3 SV=1 727 945 5.0E-14
sp|Q2FED7|HRTA_STAA3 Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain USA300) GN=hrtA PE=3 SV=1 727 945 5.0E-14
sp|P46903|NATA_BACSU ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1 110 314 6.0E-14
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 732 930 6.0E-14
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 107 306 6.0E-14
sp|Q608V9|MODC_METCA Molybdenum import ATP-binding protein ModC OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=modC PE=3 SV=1 114 317 6.0E-14
sp|Q6N999|LOLD1_RHOPA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lolD1 PE=3 SV=1 735 924 6.0E-14
sp|P94420|YCLP_BACSU Uncharacterized ABC transporter ATP-binding protein YclP OS=Bacillus subtilis (strain 168) GN=yclP PE=3 SV=1 720 985 6.0E-14
sp|A0ALT6|ECFA2_LISW6 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=ecfA2 PE=3 SV=1 709 950 6.0E-14
sp|Q9V2E4|Y130_PYRAB Putative ABC transporter ATP-binding protein PYRAB01300 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01300 PE=3 SV=1 733 955 6.0E-14
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 106 374 6.0E-14
sp|P49938|FHUC_BACSU Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Bacillus subtilis (strain 168) GN=fhuC PE=3 SV=1 97 287 6.0E-14
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 98 281 6.0E-14
sp|Q8DZJ0|POTA_STRA5 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=potA PE=3 SV=1 735 929 6.0E-14
sp|Q8E554|POTA_STRA3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=potA PE=3 SV=1 735 929 6.0E-14
sp|Q3K0Y6|POTA_STRA1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=potA PE=3 SV=1 735 929 6.0E-14
sp|Q6FYL0|MACB_BARQU Macrolide export ATP-binding/permease protein MacB OS=Bartonella quintana (strain Toulouse) GN=macB PE=3 SV=1 105 302 6.0E-14
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 117 388 7.0E-14
sp|P63374|PSTB1_STRR6 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pstB1 PE=3 SV=1 732 921 7.0E-14
sp|P63373|PSTB1_STRPN Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pstB1 PE=3 SV=1 732 921 7.0E-14
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 101 287 7.0E-14
sp|Q6NA00|PHNC2_RHOPA Phosphonates import ATP-binding protein PhnC 2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=phnC2 PE=3 SV=1 104 341 7.0E-14
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 89 287 7.0E-14
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 101 287 7.0E-14
sp|O68106|CBIO_RHOCB Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1 751 955 7.0E-14
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 750 909 7.0E-14
sp|Q0SWH9|ECFA2_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA2 PE=3 SV=1 736 923 7.0E-14
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 107 306 7.0E-14
sp|A1SWH9|UGPC_PSYIN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Psychromonas ingrahamii (strain 37) GN=ugpC PE=3 SV=1 110 306 7.0E-14
sp|Q48J29|MODC_PSE14 Molybdenum import ATP-binding protein ModC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=modC PE=3 SV=1 114 317 7.0E-14
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 732 930 7.0E-14
sp|Q2J1U0|MODC_RHOP2 Molybdenum import ATP-binding protein ModC OS=Rhodopseudomonas palustris (strain HaA2) GN=modC PE=3 SV=1 101 316 8.0E-14
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 106 288 8.0E-14
sp|Q608V9|MODC_METCA Molybdenum import ATP-binding protein ModC OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=modC PE=3 SV=1 739 958 8.0E-14
sp|P49938|FHUC_BACSU Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Bacillus subtilis (strain 168) GN=fhuC PE=3 SV=1 733 955 8.0E-14
sp|Q1MCN6|UGPC1_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC1 PE=3 SV=1 106 422 8.0E-14
sp|O69063|HTXD_PSEST Hypophosphite import ATP-binding protein HtxD OS=Pseudomonas stutzeri GN=htxD PE=3 SV=1 727 966 8.0E-14
sp|Q03ZQ0|POTA_LEUMM Spermidine/putrescine import ATP-binding protein PotA OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=potA PE=3 SV=1 735 929 8.0E-14
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 732 923 8.0E-14
sp|Q4KC87|FBPC_PSEF5 Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fbpC PE=3 SV=1 739 987 9.0E-14
sp|P48243|GLUA_CORGL Glutamate transport ATP-binding protein GluA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gluA PE=3 SV=2 736 924 9.0E-14
sp|P63402|Y2593_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb2593 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2593 PE=3 SV=1 746 926 9.0E-14
sp|P9WQI5|Y2564_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv2564 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2564 PE=1 SV=1 746 926 9.0E-14
sp|P9WQI4|Y2564_MYCTO Uncharacterized ABC transporter ATP-binding protein MT2640 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2640 PE=3 SV=1 746 926 9.0E-14
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 728 950 9.0E-14
sp|Q927N9|ECFA2_LISIN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ecfA2 PE=3 SV=1 709 950 9.0E-14
sp|Q2W1R8|MODC_MAGSA Molybdenum import ATP-binding protein ModC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=modC PE=3 SV=1 748 959 9.0E-14
sp|Q5P4W2|MODC_AROAE Molybdenum import ATP-binding protein ModC OS=Aromatoleum aromaticum (strain EbN1) GN=modC PE=3 SV=1 114 314 1.0E-13
sp|Q2K2X0|MODC_RHIEC Molybdenum import ATP-binding protein ModC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=modC PE=3 SV=1 117 317 1.0E-13
sp|Q5WBL0|SSUB3_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Bacillus clausii (strain KSM-K16) GN=ssuB3 PE=3 SV=1 728 926 1.0E-13
sp|Q8DUF7|POTA_STRMU Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=potA PE=3 SV=1 735 929 1.0E-13
sp|P0AAG3|GLTL_ECOLI Glutamate/aspartate transport ATP-binding protein GltL OS=Escherichia coli (strain K12) GN=gltL PE=3 SV=1 753 924 1.0E-13
sp|P0AAG4|GLTL_ECO57 Glutamate/aspartate transport ATP-binding protein GltL OS=Escherichia coli O157:H7 GN=gltL PE=3 SV=1 753 924 1.0E-13
sp|Q9HPH7|Y1631_HALSA Putative ABC transporter ATP-binding protein VNG_1631G OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1631G PE=3 SV=1 734 924 1.0E-13
sp|O29527|Y731_ARCFU Putative ABC transporter ATP-binding protein AF_0731 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0731 PE=3 SV=2 735 1011 1.0E-13
sp|Q5LX21|UGPC_RUEPO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ugpC PE=3 SV=1 106 306 1.0E-13
sp|Q8PGE8|METN_XANAC Methionine import ATP-binding protein MetN OS=Xanthomonas axonopodis pv. citri (strain 306) GN=metN PE=3 SV=1 715 986 1.0E-13
sp|Q2NHA1|ECFA_METST Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=ecfA PE=3 SV=1 736 923 1.0E-13
sp|Q6G1V5|MACB_BARHE Macrolide export ATP-binding/permease protein MacB OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=macB PE=3 SV=1 734 923 1.0E-13
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 101 316 1.0E-13
sp|P38046|NRTD_SYNE7 Nitrate transport ATP-binding protein NrtD OS=Synechococcus elongatus (strain PCC 7942) GN=nrtD PE=3 SV=1 107 306 1.0E-13
sp|Q6RH47|TAUB_PARPN Taurine import ATP-binding protein TauB OS=Paracoccus pantotrophus GN=tauB PE=3 SV=1 100 353 1.0E-13
sp|Q8PP41|SSUB1_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1 725 923 1.0E-13
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 119 306 1.0E-13
sp|Q6LKD4|FBPC_PHOPR Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2 728 950 1.0E-13
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 107 287 1.0E-13
sp|Q0ASQ1|PHNC_MARMM Phosphonates import ATP-binding protein PhnC OS=Maricaulis maris (strain MCS10) GN=phnC PE=3 SV=1 101 313 1.0E-13
sp|Q87AL9|METN_XYLFT Methionine import ATP-binding protein MetN OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metN PE=3 SV=1 101 346 1.0E-13
sp|Q7VKP7|MODC_HAEDU Molybdenum import ATP-binding protein ModC OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=modC PE=3 SV=1 119 306 1.0E-13
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 100 306 1.0E-13
sp|Q8Y455|ECFA2_LISMO Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ecfA2 PE=3 SV=1 709 950 1.0E-13
sp|Q5FA19|FBPC_NEIG1 Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fbpC PE=1 SV=1 106 333 1.0E-13
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 101 287 1.0E-13
sp|Q71WH8|ECFA2_LISMF Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ecfA2 PE=3 SV=1 709 950 1.0E-13
sp|Q7NUJ3|MACB_CHRVO Macrolide export ATP-binding/permease protein MacB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=macB PE=3 SV=1 735 923 1.0E-13
sp|Q3ATR5|MACB_CHLCH Macrolide export ATP-binding/permease protein MacB OS=Chlorobium chlorochromatii (strain CaD3) GN=macB PE=3 SV=1 107 338 1.0E-13
sp|P37732|MODC1_AZOVI Molybdenum import ATP-binding protein ModC 1 OS=Azotobacter vinelandii GN=modC1 PE=3 SV=2 739 946 2.0E-13
sp|Q9JVR5|MACB_NEIMA Macrolide export ATP-binding/permease protein MacB OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=macB PE=3 SV=1 97 289 2.0E-13
sp|Q3BNZ3|METN_XANC5 Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=metN PE=3 SV=1 715 986 2.0E-13
sp|Q9KGD6|ECFA2_BACHD Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ecfA2 PE=3 SV=1 732 944 2.0E-13
sp|Q1I7I9|MACB2_PSEE4 Macrolide export ATP-binding/permease protein MacB 2 OS=Pseudomonas entomophila (strain L48) GN=macB2 PE=3 SV=1 722 923 2.0E-13
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 97 306 2.0E-13
sp|Q8TYV9|Y182_METKA Putative ABC transporter ATP-binding protein MK0182 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0182 PE=3 SV=1 750 970 2.0E-13
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 719 958 2.0E-13
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 105 306 2.0E-13
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 105 306 2.0E-13
sp|Q9PF03|METN_XYLFA Methionine import ATP-binding protein MetN OS=Xylella fastidiosa (strain 9a5c) GN=metN PE=3 SV=1 101 346 2.0E-13
sp|Q13ZJ1|NODI_BURXL Nod factor export ATP-binding protein I OS=Burkholderia xenovorans (strain LB400) GN=nodI PE=3 SV=1 104 312 2.0E-13
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 101 307 2.0E-13
sp|Q0VT01|MACB_ALCBS Macrolide export ATP-binding/permease protein MacB OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=macB PE=3 SV=1 735 926 2.0E-13
sp|Q8RLB6|SSUB_DELAC Aliphatic sulfonates import ATP-binding protein SsuB OS=Delftia acidovorans GN=ssuB PE=3 SV=1 104 306 2.0E-13
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 101 287 2.0E-13
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 101 307 2.0E-13
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 728 950 2.0E-13
sp|Q881U6|SSUB2_PSESM Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB2 PE=3 SV=1 720 930 2.0E-13
sp|Q08381|MODC_RHOCA Molybdenum import ATP-binding protein ModC OS=Rhodobacter capsulatus GN=modC PE=3 SV=1 101 314 2.0E-13
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 107 306 2.0E-13
sp|Q4W575|FBPC_NEIMB Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbpC PE=3 SV=1 106 333 2.0E-13
sp|Q9JVH1|FBPC_NEIMA Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fbpC PE=3 SV=1 106 333 2.0E-13
sp|O34900|TCYN_BACSU L-cystine import ATP-binding protein TcyN OS=Bacillus subtilis (strain 168) GN=tcyN PE=1 SV=1 735 960 2.0E-13
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 107 306 2.0E-13
sp|Q6GE75|HRTA_STAAR Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain MRSA252) GN=hrtA PE=3 SV=1 727 945 2.0E-13
sp|Q2S3A3|LOLD_SALRD Lipoprotein-releasing system ATP-binding protein LolD OS=Salinibacter ruber (strain DSM 13855 / M31) GN=lolD PE=3 SV=1 117 289 2.0E-13
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 101 307 2.0E-13
sp|P0C0E2|SRTF_STRPY Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes GN=srtF PE=3 SV=1 728 923 2.0E-13
sp|P0C0E3|SRTF_STRP1 Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes serotype M1 GN=srtF PE=3 SV=1 728 923 2.0E-13
sp|Q0TUN8|ECFA3_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA3 PE=1 SV=1 736 923 2.0E-13
sp|Q2SJY7|POTA_HAHCH Spermidine/putrescine import ATP-binding protein PotA OS=Hahella chejuensis (strain KCTC 2396) GN=potA PE=3 SV=1 728 974 2.0E-13
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 106 289 2.0E-13
sp|O07016|YVFR_BACSU Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1 104 287 3.0E-13
sp|Q8T5Z7|ABCA1_DICDI ABC transporter A family member 1 OS=Dictyostelium discoideum GN=abcA1 PE=2 SV=1 731 963 3.0E-13
sp|Q8PGE8|METN_XANAC Methionine import ATP-binding protein MetN OS=Xanthomonas axonopodis pv. citri (strain 306) GN=metN PE=3 SV=1 101 351 3.0E-13
sp|Q7UX73|LOLD1_RHOBA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lolD1 PE=3 SV=1 101 302 3.0E-13
sp|Q65M64|SSUB_BACLD Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ssuB PE=3 SV=1 97 304 3.0E-13
sp|Q7CJG3|MACB2_YERPE Macrolide export ATP-binding/permease protein MacB 2 OS=Yersinia pestis GN=macB2 PE=3 SV=1 102 368 3.0E-13
sp|Q1C5W7|MACB2_YERPA Macrolide export ATP-binding/permease protein MacB 2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=macB2 PE=3 SV=1 102 368 3.0E-13
sp|Q1CJW8|MACB1_YERPN Macrolide export ATP-binding/permease protein MacB 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=macB1 PE=3 SV=1 102 368 3.0E-13
sp|Q57SD6|PHNT_SALCH Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella choleraesuis (strain SC-B67) GN=phnT PE=3 SV=1 733 914 3.0E-13
sp|Q8UCD5|MODC_AGRFC Molybdenum import ATP-binding protein ModC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=modC PE=3 SV=1 117 306 3.0E-13
sp|Q3ISC1|PHNC1_NATPD Phosphonates import ATP-binding protein PhnC 1 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC1 PE=3 SV=1 107 305 3.0E-13
sp|Q92CK1|Y1170_LISIN Putative ABC transporter ATP-binding protein lin1170 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin1170 PE=3 SV=1 733 955 3.0E-13
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 101 307 3.0E-13
sp|Q2IXX0|MACB_RHOP2 Macrolide export ATP-binding/permease protein MacB OS=Rhodopseudomonas palustris (strain HaA2) GN=macB PE=3 SV=1 736 925 3.0E-13
sp|Q92WJ0|FBPC1_RHIME Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhizobium meliloti (strain 1021) GN=fbpC1 PE=3 SV=1 734 1005 3.0E-13
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 109 317 3.0E-13
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 101 307 3.0E-13
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 101 307 3.0E-13
sp|Q8Y7R4|Y1207_LISMO Putative ABC transporter ATP-binding protein lmo1207 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo1207 PE=3 SV=1 733 923 3.0E-13
sp|Q1PEH6|AB3A_ARATH ABC transporter A family member 3 OS=Arabidopsis thaliana GN=ABCA3 PE=2 SV=3 94 293 3.0E-13
sp|P44986|THIQ_HAEIN Thiamine import ATP-binding protein ThiQ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thiQ PE=1 SV=2 730 942 3.0E-13
sp|Q72FW5|POTA_DESVH Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=potA PE=3 SV=1 107 306 3.0E-13
sp|D5AQY6|NIKO_RHOCB Nickel import ATP-binding protein NikO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=nikO PE=1 SV=1 736 955 3.0E-13
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 1107 1337 3.0E-13
sp|Q135Z8|LOLD_RHOPS Lipoprotein-releasing system ATP-binding protein LolD OS=Rhodopseudomonas palustris (strain BisB5) GN=lolD PE=3 SV=1 734 911 3.0E-13
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 113 287 4.0E-13
sp|Q5NHP2|LOLD_FRATT Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=lolD PE=3 SV=1 106 299 4.0E-13
sp|Q2A4V5|LOLD_FRATH Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain LVS) GN=lolD PE=3 SV=1 106 299 4.0E-13
sp|Q14J44|LOLD_FRAT1 Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=lolD PE=3 SV=1 106 299 4.0E-13
sp|Q9CM47|MACB_PASMU Macrolide export ATP-binding/permease protein MacB OS=Pasteurella multocida (strain Pm70) GN=macB PE=3 SV=1 99 287 4.0E-13
sp|Q668L6|MACB2_YERPS Macrolide export ATP-binding/permease protein MacB 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=macB2 PE=3 SV=1 102 368 4.0E-13
sp|Q4ZT65|MACB2_PSEU2 Macrolide export ATP-binding/permease protein MacB 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=macB2 PE=3 SV=1 736 926 4.0E-13
sp|Q7N8B9|FBPC_PHOLL Fe(3+) ions import ATP-binding protein FbpC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbpC PE=3 SV=1 728 958 4.0E-13
sp|Q8D3Z9|Y5533_VIBVU Putative ABC transporter ATP-binding protein VV2_1533 OS=Vibrio vulnificus (strain CMCP6) GN=VV2_1533 PE=3 SV=2 733 959 4.0E-13
sp|P55604|Y4OS_RHISN Uncharacterized ABC transporter ATP-binding protein y4oS OS=Rhizobium sp. (strain NGR234) GN=NGR_a02170 PE=3 SV=1 105 306 4.0E-13
sp|Q2YKZ7|Y2993_BRUA2 Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1 105 306 4.0E-13
sp|Q578M5|Y2787_BRUAB Putative ATP-binding protein BruAb2_0487 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0487 PE=3 SV=1 105 306 4.0E-13
sp|Q7M8U0|MACB_WOLSU Macrolide export ATP-binding/permease protein MacB OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=macB PE=3 SV=1 106 287 4.0E-13
sp|Q8FVT0|Y3745_BRUSU Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1 105 306 4.0E-13
sp|Q73R11|Y282_TREDE Putative ABC transporter ATP-binding protein TDE_0282 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_0282 PE=3 SV=1 101 287 4.0E-13
sp|Q21UI2|MODC_RHOFT Molybdenum import ATP-binding protein ModC OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=modC PE=3 SV=1 748 955 4.0E-13
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 104 312 4.0E-13
sp|Q2P7S3|METN_XANOM Methionine import ATP-binding protein MetN OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=metN PE=3 SV=1 724 986 4.0E-13
sp|O34392|YTRE_BACSU ABC transporter ATP-binding protein YtrE OS=Bacillus subtilis (strain 168) GN=ytrE PE=2 SV=1 106 287 4.0E-13
sp|Q5E0T4|MODC_VIBF1 Molybdenum import ATP-binding protein ModC OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=modC PE=3 SV=1 106 337 4.0E-13
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 100 287 4.0E-13
sp|P45247|LOLD_HAEIN Lipoprotein-releasing system ATP-binding protein LolD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lolD PE=3 SV=1 101 272 4.0E-13
sp|Q4QKQ9|LOLD_HAEI8 Lipoprotein-releasing system ATP-binding protein LolD OS=Haemophilus influenzae (strain 86-028NP) GN=lolD PE=3 SV=1 101 272 4.0E-13
sp|Q5PFQ7|PHNT_SALPA Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phnT PE=3 SV=1 733 914 4.0E-13
sp|Q8Z8W8|PHNT_SALTI Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhi GN=phnT PE=3 SV=1 733 914 4.0E-13
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 746 1041 4.0E-13
sp|Q5P4W2|MODC_AROAE Molybdenum import ATP-binding protein ModC OS=Aromatoleum aromaticum (strain EbN1) GN=modC PE=3 SV=1 751 958 6.0E-13
sp|Q21UI2|MODC_RHOFT Molybdenum import ATP-binding protein ModC OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=modC PE=3 SV=1 119 313 6.0E-13
sp|Q0BN75|LOLD_FRATO Lipoprotein-releasing system ATP-binding protein LolD OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=lolD PE=3 SV=1 106 299 7.0E-13
sp|Q5MK06|MACB_NEIGO Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae GN=macB PE=1 SV=1 717 923 7.0E-13
sp|Q1RFH8|TAUB_ECOUT Taurine import ATP-binding protein TauB OS=Escherichia coli (strain UTI89 / UPEC) GN=tauB PE=3 SV=1 104 306 7.0E-13
sp|Q0TKS1|TAUB_ECOL5 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tauB PE=3 SV=1 104 306 7.0E-13
sp|Q2S3A3|LOLD_SALRD Lipoprotein-releasing system ATP-binding protein LolD OS=Salinibacter ruber (strain DSM 13855 / M31) GN=lolD PE=3 SV=1 719 954 7.0E-13
sp|Q8FKF5|TAUB_ECOL6 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tauB PE=3 SV=1 104 306 8.0E-13
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 727 923 8.0E-13
sp|Q83LR7|MACB_SHIFL Macrolide export ATP-binding/permease protein MacB OS=Shigella flexneri GN=macB PE=3 SV=1 106 290 8.0E-13
sp|Q325N3|TAUB_SHIBS Taurine import ATP-binding protein TauB OS=Shigella boydii serotype 4 (strain Sb227) GN=tauB PE=3 SV=1 104 306 9.0E-13
sp|Q8X5I6|TAUB_ECO57 Taurine import ATP-binding protein TauB OS=Escherichia coli O157:H7 GN=tauB PE=3 SV=1 104 306 1.0E-12
sp|Q2VZJ1|CCMA_MAGSA Cytochrome c biogenesis ATP-binding export protein CcmA OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=ccmA PE=3 SV=1 114 287 1.0E-12
sp|Q6RH47|TAUB_PARPN Taurine import ATP-binding protein TauB OS=Paracoccus pantotrophus GN=tauB PE=3 SV=1 734 930 1.0E-12
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 746 909 1.0E-12
sp|Q5F6V6|MACB_NEIG1 Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=macB PE=3 SV=1 732 923 1.0E-12
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 720 923 1.0E-12
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 726 962 1.0E-12
sp|Q2RWI9|MODC_RHORT Molybdenum import ATP-binding protein ModC OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=modC PE=3 SV=1 739 955 1.0E-12
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 733 924 2.0E-12
sp|Q3Z542|TAUB_SHISS Taurine import ATP-binding protein TauB OS=Shigella sonnei (strain Ss046) GN=tauB PE=3 SV=1 104 306 2.0E-12
sp|Q47538|TAUB_ECOLI Taurine import ATP-binding protein TauB OS=Escherichia coli (strain K12) GN=tauB PE=2 SV=1 104 306 2.0E-12
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 106 288 2.0E-12
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 732 923 2.0E-12
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 732 923 2.0E-12
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 733 924 2.0E-12
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 1098 1371 2.0E-12
sp|Q55463|CMPD_SYNY3 Bicarbonate transport ATP-binding protein CmpD OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cmpD PE=2 SV=1 734 949 2.0E-12
sp|Q668Q3|FBPC_YERPS Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fbpC PE=3 SV=1 727 954 2.0E-12
sp|Q1CJS9|FBPC_YERPN Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fbpC PE=3 SV=1 727 954 2.0E-12
sp|Q8ZCM2|FBPC_YERPE Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis GN=fbpC PE=3 SV=1 727 954 2.0E-12
sp|Q1C607|FBPC_YERPA Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fbpC PE=3 SV=1 727 954 2.0E-12
sp|Q4FU75|MACB_PSYA2 Macrolide export ATP-binding/permease protein MacB OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=macB PE=3 SV=1 102 333 2.0E-12
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 732 957 3.0E-12
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 105 306 3.0E-12
sp|Q58206|Y796_METJA Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1 107 287 3.0E-12
sp|Q9PF03|METN_XYLFA Methionine import ATP-binding protein MetN OS=Xylella fastidiosa (strain 9a5c) GN=metN PE=3 SV=1 734 989 3.0E-12
sp|Q03PF2|POTA_LACBA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1 104 312 3.0E-12
sp|Q6D7D0|MODC_PECAS Molybdenum import ATP-binding protein ModC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=modC PE=3 SV=1 739 946 3.0E-12
sp|O34392|YTRE_BACSU ABC transporter ATP-binding protein YtrE OS=Bacillus subtilis (strain 168) GN=ytrE PE=2 SV=1 735 923 3.0E-12
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 724 960 4.0E-12
sp|Q32IZ6|TAUB_SHIDS Taurine import ATP-binding protein TauB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tauB PE=3 SV=1 104 306 4.0E-12
sp|Q2P7S3|METN_XANOM Methionine import ATP-binding protein MetN OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=metN PE=3 SV=1 101 351 4.0E-12
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 99 317 4.0E-12
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 739 951 4.0E-12
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 104 288 5.0E-12
sp|Q9K0N7|MACB_NEIMB Macrolide export ATP-binding/permease protein MacB OS=Neisseria meningitidis serogroup B (strain MC58) GN=macB PE=3 SV=1 717 923 5.0E-12
sp|Q3BNZ3|METN_XANC5 Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=metN PE=3 SV=1 101 351 5.0E-12
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 104 314 5.0E-12
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 722 1041 5.0E-12
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 736 957 6.0E-12
sp|Q88G95|MODC_PSEPK Molybdenum import ATP-binding protein ModC OS=Pseudomonas putida (strain KT2440) GN=modC PE=3 SV=1 729 955 7.0E-12
sp|Q8PP41|SSUB1_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1 103 303 8.0E-12
sp|Q4L8L7|HRTA_STAHJ Putative hemin import ATP-binding protein HrtA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hrtA PE=3 SV=1 97 273 8.0E-12
sp|Q6G1V5|MACB_BARHE Macrolide export ATP-binding/permease protein MacB OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=macB PE=3 SV=1 105 287 9.0E-12
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 395 612 9.0E-12
sp|P97027|SSUB_BACSU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus subtilis (strain 168) GN=ssuB PE=1 SV=4 732 942 1.0E-11
sp|A0B212|MACB_BURCH Macrolide export ATP-binding/permease protein MacB OS=Burkholderia cenocepacia (strain HI2424) GN=macB PE=3 SV=1 106 311 1.0E-11
sp|Q1BPZ6|MACB_BURCA Macrolide export ATP-binding/permease protein MacB OS=Burkholderia cenocepacia (strain AU 1054) GN=macB PE=3 SV=2 106 305 1.0E-11
sp|Q65TH4|MACB_MANSM Macrolide export ATP-binding/permease protein MacB OS=Mannheimia succiniciproducens (strain MBEL55E) GN=macB PE=3 SV=1 102 302 1.0E-11
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 746 909 1.0E-11
sp|Q8RD07|Y246_CALS4 Putative ABC transporter ATP-binding protein TTE0246 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE0246 PE=3 SV=1 122 287 1.0E-11
sp|Q48J29|MODC_PSE14 Molybdenum import ATP-binding protein ModC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=modC PE=3 SV=1 740 958 1.0E-11
sp|Q4FMG5|TAUB_PELUB Taurine import ATP-binding protein TauB OS=Pelagibacter ubique (strain HTCC1062) GN=tauB PE=3 SV=1 101 287 2.0E-11
sp|Q98KI3|MODC_RHILO Molybdenum import ATP-binding protein ModC OS=Rhizobium loti (strain MAFF303099) GN=modC PE=3 SV=1 739 955 2.0E-11
sp|Q1CGD7|MACB2_YERPN Macrolide export ATP-binding/permease protein MacB 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=macB2 PE=3 SV=1 106 289 2.0E-11
sp|Q66CL2|MACB1_YERPS Macrolide export ATP-binding/permease protein MacB 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=macB1 PE=3 SV=1 106 289 2.0E-11
sp|Q7CHI2|MACB1_YERPE Macrolide export ATP-binding/permease protein MacB 1 OS=Yersinia pestis GN=macB1 PE=3 SV=1 106 289 2.0E-11
sp|Q1CA99|MACB1_YERPA Macrolide export ATP-binding/permease protein MacB 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=macB1 PE=3 SV=1 106 289 2.0E-11
sp|Q217L2|MACB_RHOPB Macrolide export ATP-binding/permease protein MacB OS=Rhodopseudomonas palustris (strain BisB18) GN=macB PE=3 SV=1 114 311 2.0E-11
sp|Q9JVR5|MACB_NEIMA Macrolide export ATP-binding/permease protein MacB OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=macB PE=3 SV=1 717 923 2.0E-11
sp|A1K323|MACB_AZOSB Macrolide export ATP-binding/permease protein MacB OS=Azoarcus sp. (strain BH72) GN=macB PE=3 SV=1 106 322 2.0E-11
sp|P45092|ARTP_HAEIN Arginine transport ATP-binding protein ArtP OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=artP PE=3 SV=1 101 288 2.0E-11
sp|Q1QDA8|MACB_PSYCK Macrolide export ATP-binding/permease protein MacB OS=Psychrobacter cryohalolentis (strain K5) GN=macB PE=3 SV=1 102 333 2.0E-11
sp|Q7CN92|POTA_STRP8 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1 106 312 2.0E-11
sp|Q99ZS8|POTA_STRP1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1 106 312 2.0E-11
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 734 914 2.0E-11
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 106 312 2.0E-11
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 106 312 2.0E-11
sp|Q81C68|SSUB_BACCR Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ssuB PE=3 SV=1 735 943 2.0E-11
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 739 950 2.0E-11
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 106 312 2.0E-11
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 106 312 2.0E-11
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 720 923 2.0E-11
sp|Q83MA0|TAUB_SHIFL Taurine import ATP-binding protein TauB OS=Shigella flexneri GN=tauB PE=3 SV=1 104 306 2.0E-11
sp|P63374|PSTB1_STRR6 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pstB1 PE=3 SV=1 104 285 2.0E-11
sp|P63373|PSTB1_STRPN Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pstB1 PE=3 SV=1 104 285 2.0E-11
sp|Q6NA00|PHNC2_RHOPA Phosphonates import ATP-binding protein PhnC 2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=phnC2 PE=3 SV=1 732 952 2.0E-11
sp|Q2J1U0|MODC_RHOP2 Molybdenum import ATP-binding protein ModC OS=Rhodopseudomonas palustris (strain HaA2) GN=modC PE=3 SV=1 751 954 3.0E-11
sp|P48243|GLUA_CORGL Glutamate transport ATP-binding protein GluA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gluA PE=3 SV=2 107 321 3.0E-11
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 107 287 3.0E-11
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 103 316 3.0E-11
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 728 923 3.0E-11
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 728 923 3.0E-11
sp|Q0K2U3|TAUB_CUPNH Taurine import ATP-binding protein TauB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tauB PE=3 SV=1 101 341 3.0E-11
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 728 923 3.0E-11
sp|Q21GS5|MODC_SACD2 Molybdenum import ATP-binding protein ModC OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=modC PE=3 SV=1 119 315 3.0E-11
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 103 316 3.0E-11
sp|P0C2H2|MACB_ECOLX Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli GN=macB PE=3 SV=1 733 949 3.0E-11
sp|P0C2H3|MACB2_ECOK1 Macrolide export ATP-binding/permease protein MacB 2 OS=Escherichia coli O1:K1 / APEC GN=macB2 PE=3 SV=1 733 949 3.0E-11
sp|Q1IGM2|TAUB_PSEE4 Taurine import ATP-binding protein TauB OS=Pseudomonas entomophila (strain L48) GN=tauB PE=3 SV=1 100 304 3.0E-11
sp|Q58967|Y1572_METJA Putative ABC transporter ATP-binding protein MJ1572 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1572 PE=3 SV=1 107 287 3.0E-11
sp|Q3A558|LOLD_PELCD Lipoprotein-releasing system ATP-binding protein LolD OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lolD PE=3 SV=1 102 301 3.0E-11
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 106 312 3.0E-11
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 106 312 3.0E-11
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 106 312 3.0E-11
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 106 312 3.0E-11
sp|Q399M3|MACB_BURL3 Macrolide export ATP-binding/permease protein MacB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=macB PE=3 SV=1 106 311 3.0E-11
sp|Q3KJQ7|TAUB_PSEPF Taurine import ATP-binding protein TauB OS=Pseudomonas fluorescens (strain Pf0-1) GN=tauB PE=3 SV=1 100 304 3.0E-11
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 739 924 3.0E-11
sp|P0AAF9|ARTP_SHIFL Arginine transport ATP-binding protein ArtP OS=Shigella flexneri GN=artP PE=3 SV=1 101 316 3.0E-11
sp|P0AAF6|ARTP_ECOLI Arginine transport ATP-binding protein ArtP OS=Escherichia coli (strain K12) GN=artP PE=1 SV=1 101 316 3.0E-11
sp|P0AAF7|ARTP_ECOL6 Arginine transport ATP-binding protein ArtP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=artP PE=3 SV=1 101 316 3.0E-11
sp|P0AAF8|ARTP_ECO57 Arginine transport ATP-binding protein ArtP OS=Escherichia coli O157:H7 GN=artP PE=3 SV=1 101 316 3.0E-11
sp|Q8DUF7|POTA_STRMU Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=potA PE=3 SV=1 106 312 4.0E-11
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 104 288 4.0E-11
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 736 929 4.0E-11
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 736 957 4.0E-11
sp|P39456|TCYC_BACSU L-cystine import ATP-binding protein TcyC OS=Bacillus subtilis (strain 168) GN=tcyC PE=1 SV=4 106 316 4.0E-11
sp|Q3SQZ1|MACB_NITWN Macrolide export ATP-binding/permease protein MacB OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=macB PE=3 SV=1 107 308 4.0E-11
sp|Q8UCD5|MODC_AGRFC Molybdenum import ATP-binding protein ModC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=modC PE=3 SV=1 742 955 4.0E-11
sp|Q2IXX0|MACB_RHOP2 Macrolide export ATP-binding/permease protein MacB OS=Rhodopseudomonas palustris (strain HaA2) GN=macB PE=3 SV=1 114 305 4.0E-11
sp|Q7N8B9|FBPC_PHOLL Fe(3+) ions import ATP-binding protein FbpC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbpC PE=3 SV=1 103 306 4.0E-11
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 728 923 4.0E-11
sp|Q88ZJ6|POTA_LACPL Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=potA PE=3 SV=1 106 306 5.0E-11
sp|Q9WYI7|Y352_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0352 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0352 PE=3 SV=1 107 287 5.0E-11
sp|Q88RA1|TAUB_PSEPK Taurine import ATP-binding protein TauB OS=Pseudomonas putida (strain KT2440) GN=tauB PE=3 SV=1 100 304 5.0E-11
sp|Q4KK16|TAUB_PSEF5 Taurine import ATP-binding protein TauB OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tauB PE=3 SV=1 100 304 5.0E-11
sp|Q92NU9|MACB_RHIME Macrolide export ATP-binding/permease protein MacB OS=Rhizobium meliloti (strain 1021) GN=macB PE=3 SV=1 735 923 6.0E-11
sp|D5AQY6|NIKO_RHOCB Nickel import ATP-binding protein NikO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=nikO PE=1 SV=1 107 313 6.0E-11
sp|P55604|Y4OS_RHISN Uncharacterized ABC transporter ATP-binding protein y4oS OS=Rhizobium sp. (strain NGR234) GN=NGR_a02170 PE=3 SV=1 734 950 6.0E-11
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 722 1012 6.0E-11
sp|P07821|FHUC_ECOLI Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Escherichia coli (strain K12) GN=fhuC PE=1 SV=3 100 287 7.0E-11
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 736 995 7.0E-11
sp|Q8KZR4|TAUB_PSEPU Taurine import ATP-binding protein TauB OS=Pseudomonas putida GN=tauB PE=3 SV=1 100 304 7.0E-11
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 104 313 7.0E-11
sp|Q7M8U0|MACB_WOLSU Macrolide export ATP-binding/permease protein MacB OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=macB PE=3 SV=1 735 950 7.0E-11
sp|Q82VK1|MACB_NITEU Macrolide export ATP-binding/permease protein MacB OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=macB PE=3 SV=1 97 287 8.0E-11
sp|O34677|GLNQ_BACSU Glutamine transport ATP-binding protein GlnQ OS=Bacillus subtilis (strain 168) GN=glnQ PE=2 SV=1 106 288 8.0E-11
sp|Q8DZJ0|POTA_STRA5 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=potA PE=3 SV=1 106 312 9.0E-11
sp|Q8E554|POTA_STRA3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=potA PE=3 SV=1 106 312 9.0E-11
sp|Q3K0Y6|POTA_STRA1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=potA PE=3 SV=1 106 312 9.0E-11
sp|Q2K2X0|MODC_RHIEC Molybdenum import ATP-binding protein ModC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=modC PE=3 SV=1 742 955 1.0E-10
sp|Q6LKD4|FBPC_PHOPR Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2 104 316 1.0E-10
sp|Q0T7M2|TAUB_SHIF8 Taurine import ATP-binding protein TauB OS=Shigella flexneri serotype 5b (strain 8401) GN=tauB PE=3 SV=1 104 306 1.0E-10
sp|Q8UKE4|MACB_AGRFC Macrolide export ATP-binding/permease protein MacB OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=macB PE=3 SV=1 106 325 1.0E-10
sp|Q08381|MODC_RHOCA Molybdenum import ATP-binding protein ModC OS=Rhodobacter capsulatus GN=modC PE=3 SV=1 748 954 1.0E-10
sp|Q1PEH6|AB3A_ARATH ABC transporter A family member 3 OS=Arabidopsis thaliana GN=ABCA3 PE=2 SV=3 751 923 1.0E-10
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 728 923 2.0E-10
sp|P63402|Y2593_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb2593 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2593 PE=3 SV=1 107 290 2.0E-10
sp|P9WQI5|Y2564_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv2564 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2564 PE=1 SV=1 107 290 2.0E-10
sp|P9WQI4|Y2564_MYCTO Uncharacterized ABC transporter ATP-binding protein MT2640 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2640 PE=3 SV=1 107 290 2.0E-10
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 95 308 2.0E-10
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 724 922 2.0E-10
sp|Q471U2|TAUB_CUPPJ Taurine import ATP-binding protein TauB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tauB PE=3 SV=1 99 341 2.0E-10
sp|Q48C94|TAUB_PSE14 Taurine import ATP-binding protein TauB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tauB PE=3 SV=1 100 304 2.0E-10
sp|Q89EW7|MODC2_BRADU Molybdenum import ATP-binding protein ModC 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=modC2 PE=3 SV=1 748 950 2.0E-10
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 728 951 2.0E-10
sp|Q2KVS6|MACB_BORA1 Macrolide export ATP-binding/permease protein MacB OS=Bordetella avium (strain 197N) GN=macB PE=3 SV=2 106 308 2.0E-10
sp|P44986|THIQ_HAEIN Thiamine import ATP-binding protein ThiQ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thiQ PE=1 SV=2 117 306 2.0E-10
sp|Q9I190|MACB_PSEAE Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=macB PE=3 SV=1 106 374 2.0E-10
sp|Q1MCN6|UGPC1_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC1 PE=3 SV=1 724 957 2.0E-10
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 698 973 3.0E-10
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 728 951 3.0E-10
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 107 287 3.0E-10
sp|O31711|YKNY_BACSU Uncharacterized ABC transporter ATP-binding protein YknY OS=Bacillus subtilis (strain 168) GN=yknY PE=1 SV=1 106 312 3.0E-10
sp|Q3SJC6|MODC_THIDA Molybdenum import ATP-binding protein ModC OS=Thiobacillus denitrificans (strain ATCC 25259) GN=modC PE=3 SV=1 748 958 3.0E-10
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 679 923 3.0E-10
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 101 355 3.0E-10
sp|Q1CFP9|MODC_YERPN Molybdenum import ATP-binding protein ModC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=modC PE=3 SV=1 748 949 3.0E-10
sp|Q8ZGX6|MODC_YERPE Molybdenum import ATP-binding protein ModC OS=Yersinia pestis GN=modC PE=3 SV=1 748 949 3.0E-10
sp|Q1C951|MODC_YERPA Molybdenum import ATP-binding protein ModC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=modC PE=3 SV=1 748 949 3.0E-10
sp|Q66D71|MODC_YERPS Molybdenum import ATP-binding protein ModC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=modC PE=3 SV=1 748 949 3.0E-10
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 646 1022 3.0E-10
sp|Q02MI4|MACB_PSEAB Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=macB PE=3 SV=1 106 374 3.0E-10
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 106 313 4.0E-10
sp|Q7VKP7|MODC_HAEDU Molybdenum import ATP-binding protein ModC OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=modC PE=3 SV=1 739 947 4.0E-10
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 103 306 4.0E-10
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 718 950 4.0E-10
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 728 898 4.0E-10
sp|Q2EHL8|MACB_AGGAC Macrolide export ATP-binding/permease protein MacB OS=Aggregatibacter actinomycetemcomitans GN=macB PE=1 SV=2 97 302 4.0E-10
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 746 972 4.0E-10
sp|Q4KC87|FBPC_PSEF5 Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fbpC PE=3 SV=1 107 312 5.0E-10
sp|Q5LX21|UGPC_RUEPO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ugpC PE=3 SV=1 735 954 5.0E-10
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 729 973 5.0E-10
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 728 923 5.0E-10
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 107 287 5.0E-10
sp|Q72FW5|POTA_DESVH Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=potA PE=3 SV=1 736 950 5.0E-10
sp|Q8TIW9|Y4021_METAC Putative ABC transporter ATP-binding protein MA_4021 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4021 PE=3 SV=1 105 287 5.0E-10
sp|Q5E0T4|MODC_VIBF1 Molybdenum import ATP-binding protein ModC OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=modC PE=3 SV=1 735 945 5.0E-10
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 1109 1361 5.0E-10
sp|Q9X1Z1|ECFA1_THEMA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ecfA1 PE=1 SV=1 106 322 5.0E-10
sp|P38046|NRTD_SYNE7 Nitrate transport ATP-binding protein NrtD OS=Synechococcus elongatus (strain PCC 7942) GN=nrtD PE=3 SV=1 739 954 6.0E-10
sp|Q1I7I9|MACB2_PSEE4 Macrolide export ATP-binding/permease protein MacB 2 OS=Pseudomonas entomophila (strain L48) GN=macB2 PE=3 SV=1 106 287 6.0E-10
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 728 923 6.0E-10
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 736 951 6.0E-10
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 718 950 6.0E-10
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 729 973 6.0E-10
sp|Q0VT01|MACB_ALCBS Macrolide export ATP-binding/permease protein MacB OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=macB PE=3 SV=1 106 290 7.0E-10
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 106 288 8.0E-10
sp|Q0ASQ1|PHNC_MARMM Phosphonates import ATP-binding protein PhnC OS=Maricaulis maris (strain MCS10) GN=phnC PE=3 SV=1 736 951 8.0E-10
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 101 287 1.0E-09
sp|Q88F88|MACB_PSEPK Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas putida (strain KT2440) GN=macB PE=3 SV=1 106 302 1.0E-09
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 117 287 1.0E-09
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 107 312 1.0E-09
sp|Q03AH0|POTA_LACC3 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus casei (strain ATCC 334) GN=potA PE=3 SV=1 101 312 1.0E-09
sp|Q664P8|TAUB_YERPS Taurine import ATP-binding protein TauB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tauB PE=3 SV=1 104 306 1.0E-09
sp|Q87UH7|TAUB_PSESM Taurine import ATP-binding protein TauB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tauB PE=3 SV=1 100 304 1.0E-09
sp|Q881U6|SSUB2_PSESM Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB2 PE=3 SV=1 104 309 1.0E-09
sp|Q9KLL9|MODC_VIBCH Molybdenum import ATP-binding protein ModC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=modC PE=3 SV=1 751 954 1.0E-09
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 728 923 1.0E-09
sp|Q92CK1|Y1170_LISIN Putative ABC transporter ATP-binding protein lin1170 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin1170 PE=3 SV=1 104 312 1.0E-09
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 728 923 1.0E-09
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 728 923 1.0E-09
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 728 923 1.0E-09
sp|Q6D2F6|FBPC2_PECAS Fe(3+) ions import ATP-binding protein FbpC 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC2 PE=3 SV=1 104 320 1.0E-09
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 101 324 1.0E-09
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 100 317 2.0E-09
sp|Q6LHL2|MODC_PHOPR Molybdenum import ATP-binding protein ModC OS=Photobacterium profundum GN=modC PE=3 SV=1 751 942 2.0E-09
sp|Q9KGD6|ECFA2_BACHD Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ecfA2 PE=3 SV=1 104 312 2.0E-09
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 728 957 2.0E-09
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 728 957 2.0E-09
sp|Q5HQ70|POTA_STAEQ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=potA PE=3 SV=1 106 306 2.0E-09
sp|Q13ZJ1|NODI_BURXL Nod factor export ATP-binding protein I OS=Burkholderia xenovorans (strain LB400) GN=nodI PE=3 SV=1 728 923 2.0E-09
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 100 288 2.0E-09
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 743 1003 2.0E-09
sp|Q1CCR9|TAUB_YERPN Taurine import ATP-binding protein TauB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tauB PE=3 SV=1 104 306 2.0E-09
sp|Q8ZJD0|TAUB_YERPE Taurine import ATP-binding protein TauB OS=Yersinia pestis GN=tauB PE=3 SV=1 104 306 2.0E-09
sp|Q1C2S1|TAUB_YERPA Taurine import ATP-binding protein TauB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tauB PE=3 SV=1 104 306 2.0E-09
sp|P50332|NODI_RHIGA Nod factor export ATP-binding protein I OS=Rhizobium galegae GN=nodI PE=3 SV=1 733 955 2.0E-09
sp|Q0TUN8|ECFA3_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA3 PE=1 SV=1 107 312 2.0E-09
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 728 950 2.0E-09
sp|Q8CUY0|PHNC2_OCEIH Phosphonates import ATP-binding protein PhnC 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=phnC2 PE=3 SV=1 101 313 2.0E-09
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 415 616 2.0E-09
sp|Q4ZT65|MACB2_PSEU2 Macrolide export ATP-binding/permease protein MacB 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=macB2 PE=3 SV=1 107 305 2.0E-09
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 117 317 2.0E-09
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 751 923 2.0E-09
sp|O68106|CBIO_RHOCB Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1 100 287 2.0E-09
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 751 923 3.0E-09
sp|Q8RQL7|GLUA_COREF Glutamate transport ATP-binding protein GluA OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gluA PE=3 SV=1 107 288 3.0E-09
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 100 287 3.0E-09
sp|Q4W575|FBPC_NEIMB Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup B (strain MC58) GN=fbpC PE=3 SV=1 728 950 3.0E-09
sp|Q9JVH1|FBPC_NEIMA Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=fbpC PE=3 SV=1 728 950 3.0E-09
sp|Q57SD6|PHNT_SALCH Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella choleraesuis (strain SC-B67) GN=phnT PE=3 SV=1 104 315 3.0E-09
sp|Q3ISC1|PHNC1_NATPD Phosphonates import ATP-binding protein PhnC 1 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC1 PE=3 SV=1 724 926 3.0E-09
sp|Q8PY26|Y1038_METMA Putative ABC transporter ATP-binding protein MM_1038 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1038 PE=3 SV=2 107 330 3.0E-09
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 101 264 3.0E-09
sp|Q5PFQ7|PHNT_SALPA Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phnT PE=3 SV=1 104 315 3.0E-09
sp|Q8Z8W8|PHNT_SALTI Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhi GN=phnT PE=3 SV=1 104 315 3.0E-09
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 101 264 3.0E-09
sp|A0KAV6|TAUB_BURCH Taurine import ATP-binding protein TauB OS=Burkholderia cenocepacia (strain HI2424) GN=tauB PE=3 SV=1 103 306 4.0E-09
sp|Q1BT84|TAUB_BURCA Taurine import ATP-binding protein TauB OS=Burkholderia cenocepacia (strain AU 1054) GN=tauB PE=3 SV=1 103 306 4.0E-09
sp|Q5FA19|FBPC_NEIG1 Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fbpC PE=1 SV=1 728 950 4.0E-09
sp|O57872|Y132_PYRHO Putative ABC transporter ATP-binding protein PH0132 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0132 PE=3 SV=1 104 287 4.0E-09
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 736 974 4.0E-09
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 103 306 4.0E-09
sp|O34900|TCYN_BACSU L-cystine import ATP-binding protein TcyN OS=Bacillus subtilis (strain 168) GN=tcyN PE=1 SV=1 117 338 4.0E-09
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 1099 1329 4.0E-09
sp|Q8Y7R4|Y1207_LISMO Putative ABC transporter ATP-binding protein lmo1207 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo1207 PE=3 SV=1 104 334 4.0E-09
sp|Q4K9A4|MACB2_PSEF5 Macrolide export ATP-binding/permease protein MacB 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=macB2 PE=3 SV=1 97 287 4.0E-09
sp|A0KMJ3|MACB2_AERHH Macrolide export ATP-binding/permease protein MacB 2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=macB2 PE=3 SV=1 105 306 4.0E-09
sp|Q8RLB6|SSUB_DELAC Aliphatic sulfonates import ATP-binding protein SsuB OS=Delftia acidovorans GN=ssuB PE=3 SV=1 723 946 5.0E-09
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 751 923 5.0E-09
sp|Q2YKZ7|Y2993_BRUA2 Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1 723 950 5.0E-09
sp|Q578M5|Y2787_BRUAB Putative ATP-binding protein BruAb2_0487 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0487 PE=3 SV=1 723 950 5.0E-09
sp|Q9HT70|METN2_PSEAE Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=metN2 PE=3 SV=1 101 317 5.0E-09
sp|Q02DK6|METN2_PSEAB Methionine import ATP-binding protein MetN 2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN2 PE=3 SV=1 101 317 5.0E-09
sp|Q8FVT0|Y3745_BRUSU Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1 723 950 6.0E-09
sp|Q8D740|MODC_VIBVU Molybdenum import ATP-binding protein ModC OS=Vibrio vulnificus (strain CMCP6) GN=modC PE=3 SV=1 748 946 6.0E-09
sp|Q55BC0|ABCA8_DICDI ABC transporter A family member 8 OS=Dictyostelium discoideum GN=abcA8 PE=3 SV=1 731 963 6.0E-09
sp|Q0SWH9|ECFA2_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA2 PE=3 SV=1 107 312 7.0E-09
sp|Q6LX68|ECFA_METMP Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanococcus maripaludis (strain S2 / LL) GN=ecfA PE=3 SV=1 95 287 8.0E-09
sp|P45247|LOLD_HAEIN Lipoprotein-releasing system ATP-binding protein LolD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lolD PE=3 SV=1 735 914 8.0E-09
sp|Q4QKQ9|LOLD_HAEI8 Lipoprotein-releasing system ATP-binding protein LolD OS=Haemophilus influenzae (strain 86-028NP) GN=lolD PE=3 SV=1 735 914 8.0E-09
sp|Q7ME63|MODC_VIBVY Molybdenum import ATP-binding protein ModC OS=Vibrio vulnificus (strain YJ016) GN=modC PE=3 SV=2 748 946 8.0E-09
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 117 287 9.0E-09
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 736 980 9.0E-09
sp|Q88ZZ2|Y149_LACPL Putative ABC transporter ATP-binding protein lp_0149 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_0149 PE=3 SV=1 50 307 9.0E-09
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 106 288 1.0E-08
sp|Q39CJ6|TAUB_BURL3 Taurine import ATP-binding protein TauB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tauB PE=3 SV=1 103 306 1.0E-08
sp|Q927N9|ECFA2_LISIN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ecfA2 PE=3 SV=1 100 287 1.0E-08
sp|Q8Y455|ECFA2_LISMO Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ecfA2 PE=3 SV=1 100 287 1.0E-08
sp|Q71WH8|ECFA2_LISMF Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ecfA2 PE=3 SV=1 100 287 1.0E-08
sp|Q73R11|Y282_TREDE Putative ABC transporter ATP-binding protein TDE_0282 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_0282 PE=3 SV=1 729 923 1.0E-08
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 375 615 1.0E-08
sp|A0ALT6|ECFA2_LISW6 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=ecfA2 PE=3 SV=1 100 287 1.0E-08
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 104 434 1.0E-08
sp|Q8CPN0|POTA_STAES Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=potA PE=3 SV=1 106 306 1.0E-08
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 122 316 1.0E-08
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 736 929 1.0E-08
sp|Q03ZQ0|POTA_LEUMM Spermidine/putrescine import ATP-binding protein PotA OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=potA PE=3 SV=1 106 306 1.0E-08
sp|Q9HPH7|Y1631_HALSA Putative ABC transporter ATP-binding protein VNG_1631G OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1631G PE=3 SV=1 105 288 2.0E-08
sp|Q3IX40|UGPC_RHOS4 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ugpC PE=3 SV=1 735 951 2.0E-08
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 104 434 2.0E-08
sp|Q52815|AAPP_RHIL3 General L-amino acid transport ATP-binding protein AapP OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=aapP PE=3 SV=1 117 288 2.0E-08
sp|Q49WM4|POTA_STAS1 Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=potA PE=3 SV=1 106 306 2.0E-08
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 103 315 2.0E-08
sp|Q6GE75|HRTA_STAAR Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain MRSA252) GN=hrtA PE=3 SV=1 97 290 2.0E-08
sp|Q2SJY7|POTA_HAHCH Spermidine/putrescine import ATP-binding protein PotA OS=Hahella chejuensis (strain KCTC 2396) GN=potA PE=3 SV=1 103 317 2.0E-08
sp|Q92WJ0|FBPC1_RHIME Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhizobium meliloti (strain 1021) GN=fbpC1 PE=3 SV=1 105 386 2.0E-08
sp|Q6N999|LOLD1_RHOPA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lolD1 PE=3 SV=1 106 288 2.0E-08
sp|A3PRY1|UGPC_RHOS1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ugpC PE=3 SV=1 735 951 2.0E-08
sp|P15031|FECE_ECOLI Fe(3+) dicitrate transport ATP-binding protein FecE OS=Escherichia coli (strain K12) GN=fecE PE=2 SV=1 735 954 2.0E-08
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 751 923 3.0E-08
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 104 306 3.0E-08
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 646 923 3.0E-08
sp|Q2YZ26|HRTA_STAAB Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hrtA PE=3 SV=1 97 290 3.0E-08
sp|Q8U4L3|Y068_PYRFU Putative ABC transporter ATP-binding protein PF0068 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0068 PE=3 SV=1 104 322 3.0E-08
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 1089 1356 3.0E-08
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 102 315 3.0E-08
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 80 292 3.0E-08
sp|P0AAG3|GLTL_ECOLI Glutamate/aspartate transport ATP-binding protein GltL OS=Escherichia coli (strain K12) GN=gltL PE=3 SV=1 124 288 4.0E-08
sp|P0AAG4|GLTL_ECO57 Glutamate/aspartate transport ATP-binding protein GltL OS=Escherichia coli O157:H7 GN=gltL PE=3 SV=1 124 288 4.0E-08
sp|Q2NHA1|ECFA_METST Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=ecfA PE=3 SV=1 95 287 4.0E-08
sp|Q135Z8|LOLD_RHOPS Lipoprotein-releasing system ATP-binding protein LolD OS=Rhodopseudomonas palustris (strain BisB5) GN=lolD PE=3 SV=1 103 277 4.0E-08
sp|Q8D3Z9|Y5533_VIBVU Putative ABC transporter ATP-binding protein VV2_1533 OS=Vibrio vulnificus (strain CMCP6) GN=VV2_1533 PE=3 SV=2 104 306 4.0E-08
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 117 273 4.0E-08
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 104 312 5.0E-08
sp|Q3SRG8|LOLD_NITWN Lipoprotein-releasing system ATP-binding protein LolD OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lolD PE=3 SV=1 101 280 5.0E-08
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 751 923 5.0E-08
sp|Q4KKK8|METN1_PSEF5 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metN1 PE=3 SV=1 117 338 6.0E-08
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 740 923 7.0E-08
sp|Q67JX4|ECFA2_SYMTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ecfA2 PE=3 SV=1 107 306 7.0E-08
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 104 288 8.0E-08
sp|Q8NV47|HRTA_STAAW Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain MW2) GN=hrtA PE=3 SV=1 97 290 8.0E-08
sp|Q6G6W1|HRTA_STAAS Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain MSSA476) GN=hrtA PE=3 SV=1 97 290 8.0E-08
sp|Q7A3X3|HRTA_STAAN Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain N315) GN=hrtA PE=3 SV=1 97 290 8.0E-08
sp|Q99RR8|HRTA_STAAM Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hrtA PE=2 SV=1 97 290 8.0E-08
sp|A6QJK1|HRTA_STAAE Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain Newman) GN=hrtA PE=2 SV=1 97 290 8.0E-08
sp|Q5HDJ6|HRTA_STAAC Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain COL) GN=hrtA PE=3 SV=1 97 290 8.0E-08
sp|Q2FVR1|HRTA_STAA8 Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain NCTC 8325) GN=hrtA PE=3 SV=1 97 290 8.0E-08
sp|Q2FED7|HRTA_STAA3 Putative hemin import ATP-binding protein HrtA OS=Staphylococcus aureus (strain USA300) GN=hrtA PE=3 SV=1 97 290 8.0E-08
sp|Q55462|CMPC_SYNY3 Bicarbonate transport ATP-binding protein CmpC OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cmpC PE=2 SV=1 736 923 9.0E-08
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 728 957 1.0E-07
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 103 315 1.0E-07
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 740 923 1.0E-07
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 750 1003 2.0E-07
sp|Q8EAN3|MODC_SHEON Molybdenum import ATP-binding protein ModC OS=Shewanella oneidensis (strain MR-1) GN=modC PE=3 SV=1 739 954 2.0E-07
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 740 923 2.0E-07
sp|Q88RL5|METN1_PSEPK Methionine import ATP-binding protein MetN 1 OS=Pseudomonas putida (strain KT2440) GN=metN1 PE=3 SV=1 101 312 2.0E-07
sp|Q3KK97|METN1_PSEPF Methionine import ATP-binding protein MetN 1 OS=Pseudomonas fluorescens (strain Pf0-1) GN=metN1 PE=3 SV=1 101 338 2.0E-07
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 751 923 3.0E-07
sp|Q88ZZ2|Y149_LACPL Putative ABC transporter ATP-binding protein lp_0149 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_0149 PE=3 SV=1 736 944 3.0E-07
sp|Q9V2E4|Y130_PYRAB Putative ABC transporter ATP-binding protein PYRAB01300 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01300 PE=3 SV=1 104 316 3.0E-07
sp|A1SWH9|UGPC_PSYIN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Psychromonas ingrahamii (strain 37) GN=ugpC PE=3 SV=1 736 898 3.0E-07
sp|Q0HFA0|MODC_SHESM Molybdenum import ATP-binding protein ModC OS=Shewanella sp. (strain MR-4) GN=modC PE=3 SV=1 739 942 4.0E-07
sp|Q0HYN8|MODC_SHESR Molybdenum import ATP-binding protein ModC OS=Shewanella sp. (strain MR-7) GN=modC PE=3 SV=1 739 954 4.0E-07
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 716 923 4.0E-07
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 117 292 4.0E-07
sp|Q48PU6|METN1_PSE14 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=metN1 PE=3 SV=1 117 317 5.0E-07
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 107 317 5.0E-07
sp|Q1IGZ0|METN2_PSEE4 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas entomophila (strain L48) GN=metN2 PE=3 SV=1 101 314 6.0E-07
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 721 923 7.0E-07
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 713 985 8.0E-07
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 397 614 8.0E-07
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 750 1003 9.0E-07
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 1098 1361 1.0E-06
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 721 923 1.0E-06
sp|P94420|YCLP_BACSU Uncharacterized ABC transporter ATP-binding protein YclP OS=Bacillus subtilis (strain 168) GN=yclP PE=3 SV=1 104 313 2.0E-06
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 721 923 2.0E-06
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 751 923 4.0E-06
sp|Q4ZZR8|METN1_PSEU2 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=metN1 PE=3 SV=1 117 338 5.0E-06
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 1098 1297 5.0E-06
sp|Q87UN4|METN2_PSESM Methionine import ATP-binding protein MetN 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=metN2 PE=3 SV=1 117 317 5.0E-06
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 722 923 6.0E-06
sp|P55662|Y4TH_RHISN Probable amino-acid ABC transporter ATP-binding protein y4tH OS=Rhizobium sp. (strain NGR234) GN=NGR_a01510 PE=3 SV=1 105 321 6.0E-06
sp|O29527|Y731_ARCFU Putative ABC transporter ATP-binding protein AF_0731 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0731 PE=3 SV=2 117 288 7.0E-06
sp|Q8TYV9|Y182_METKA Putative ABC transporter ATP-binding protein MK0182 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0182 PE=3 SV=1 117 285 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005524 ATP binding Yes
GO:0016887 ATPase activity Yes
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

Domain # Start End Length
1 418 440 22
2 455 477 22
3 534 556 22
4 561 583 22
5 590 609 19
6 653 675 22
7 1113 1135 22
8 1145 1167 22
9 1197 1219 22
10 1224 1246 22
11 1253 1275 22
12 1338 1360 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10837
MAGDDAGEPKLAEDATTADETGSTGGSVPRSSGQQKGAPAARQLSLSGDDNLSLDDVEPVRVSIRDLSVSVDLAP
SWREPSTYADALLAARGGGPDGAGPGRTKTLLDSVAADLPPGSLTAIVGGSGSGKTTLLNTLAERAAGSRLSRAG
CVTFNGRPGVQAVRHAYVMQQDVLLPTLTVRETLRYAAELRLPAATSARDRARVVDEVIRELGLKECADTRIGSS
RHRGCSGGEKRRVSIGVQLLANPSVLFLDEPTTGLDATSAFQLVRGLKNLARKGRTIVTTIHQPRSEIWHLFDGL
VVLSRGGPVYSGPMRDCAPWFEARGFALPPFVNPAEHIVDIAAVDSRTPELEEESSARVEGLRTAWRLASASRFE
PVSADVGARPKRRVSGAAAARAGFFRQLLVLTGRTFKVTRRDPLGMAACILEAVFMGLTVGYLFFDLGRDLSAIR
SREGGLYYAAALQGYLILIFEVYRMTIDIATFDRESSDNCVDPLPFVLSRRLARIPIEDVPVPLIFSALSYFLAG
FDRQVDKFFIYFAVTLVNQFIAVTCAMTCVVAVRHFAGASLMANLVFTLQSLACGIFIQSNSMPVYVRWLKWVTY
TFYAFGAYVSNEFRGSFYDCPDPAGPSSPACVQYSGDYVIESLGFPRNWILRPILAMLAFVVFFCALSTLGLYLF
KPGMAIARSRTADTDLSAGKEKPMAYCIEKVRTIDLGLDQFCLALDKRSISGKKLPRKTILNPVNATFEAGVLNV
IMGPSGSGKTSLLNAMALRLRNSAGSRYRPYGKLTFNGAVPSDSVIRSVCSYVCQDDDALLPSLTVRETLRFAAG
LRLPSSMSRAEKNRRADEVLMRMGLKDCANTLIGSELIRGISGGEKRRVSIAVQILTDPRILLLDEPTSGLDAFT
ASSIMEVLKGLASEGRTLVLTIHQARSDLFRHFGNVLLLARGGCTAFAGPAAEMLGHFGKYGYECPQHTNPADFA
LDLITIDLQRDDREATSRERVQRLIEEWKGHEGKSLDKASHLPGGIGELEESSNEPLDSPGAKDTAQAKQEILTG
ETARGKSSASHKHGHAGRKSFNKASVSTPAELGALVRKRASLPVALPLLLRRATINARRQPELILARTMQVIGLA
IVLALFFAPLGNDYFSVQSRMGLVQEVGALYFVGMLQNVAVYPSERDVFYREDEDGVYGVDAFLAAYTILEVPFE
VFSCLVFGALAVVAVGLPLTATMYFVAVFVCFGLVSCGESLGIMFNTLFGHTGFAVNIMGVFLAVAAGMAGVLSI
DMPDLFRAANYLSPARYATRAVAPYSLRGVSFTCSDGQRLPDGSCPVETGSQVLQLYKLDVDPVVNVAAMAACVV
VYRLLAWVLLRVMRARWRDKRAPTTSELASGG*
Coding >Hirsu2|10837
ATGGCCGGCGACGACGCTGGCGAGCCCAAGCTGGCCGAGGACGCCACCACCGCGGACGAGACGGGCTCGACGGGT
GGCTCCGTGCCCCGGTCTTCCGGGCAGCAGAAGGGGGCGCCGGCGGCGCGGCAGCTTTCGCTGTCCGGCGACGAC
AATCTCTCGCTCGACGATGTCGAGCCCGTGCGCGTCAGCATCCGCGACCTCTCCGTCTCGGTCGACCTGGCGCCG
TCCTGGCGCGAGCCGTCGACGTACGCCGACGCGCTGCTGGCCGCGCGGGGCGGCGGGCCCGACGGCGCCGGGCCG
GGCCGCACCAAGACGCTGCTGGACTCGGTCGCGGCCGACCTGCCGCCCGGTTCGCTCACGGCCATCGTCGGTGGC
AGCGGCTCCGGCAAGACGACGCTCCTCAACACGCTGGCCGAGAGGGCGGCCGGCTCGAGGCTGAGCCGGGCCGGC
TGCGTGACCTTCAACGGCCGGCCGGGCGTGCAGGCCGTCCGGCACGCCTACGTCATGCAGCAGGACGTCCTCCTG
CCGACCCTGACCGTCCGGGAGACGCTTCGGTACGCAGCCGAGCTGCGGCTGCCGGCCGCGACCTCGGCCCGCGAC
CGCGCCCGCGTCGTCGACGAGGTCATCCGCGAGCTCGGCCTCAAGGAGTGCGCCGACACGCGCATCGGCAGCAGC
CGGCACCGCGGCTGCTCCGGCGGCGAGAAGCGGCGCGTGAGCATCGGGGTCCAGCTGCTGGCGAACCCGTCGGTG
CTGTTCCTCGACGAGCCCACGACGGGCCTCGACGCCACGAGCGCCTTCCAGCTCGTACGGGGCCTCAAGAACCTG
GCCCGGAAGGGACGGACCATCGTCACGACCATTCACCAGCCGCGGTCCGAGATATGGCACCTCTTCGACGGCCTG
GTCGTCTTGTCCAGGGGCGGGCCGGTCTACTCCGGCCCCATGCGCGACTGTGCTCCCTGGTTCGAGGCCCGGGGC
TTTGCACTGCCCCCTTTCGTCAACCCGGCCGAGCACATCGTCGACATCGCCGCTGTGGACAGCCGGACGCCCGAG
CTGGAGGAGGAGAGCAGCGCGCGTGTCGAGGGCCTCAGGACCGCCTGGCGCTTGGCGAGCGCTTCGCGATTTGAG
CCCGTCTCCGCAGACGTCGGCGCCCGGCCGAAGAGGCGTGTCTCCGGAGCTGCCGCCGCCCGCGCAGGCTTCTTC
CGCCAGCTCCTCGTCCTGACCGGCCGCACGTTCAAGGTGACGCGTCGAGACCCGCTCGGCATGGCGGCCTGTATA
CTCGAAGCCGTCTTCATGGGCCTCACCGTCGGCTACCTGTTTTTCGACCTCGGGCGCGACTTGTCCGCCATCCGC
TCGCGGGAAGGCGGCCTGTACTATGCCGCCGCCCTGCAGGGATATCTGATTCTCATCTTCGAAGTGTATCGGATG
ACCATCGACATCGCCACCTTCGACCGCGAGTCGTCCGACAACTGTGTCGACCCGCTCCCGTTCGTTCTCTCTCGT
CGCCTAGCGCGGATACCCATCGAGGACGTGCCGGTGCCCCTGATCTTTTCCGCCCTGTCATATTTCCTGGCTGGC
TTTGACCGTCAGGTGGACAAGTTCTTCATCTACTTCGCCGTCACCCTCGTCAATCAGTTCATTGCCGTGACGTGC
GCCATGACTTGCGTCGTCGCCGTCAGGCACTTTGCCGGCGCCAGCCTGATGGCGAACCTGGTCTTCACCTTGCAG
TCCCTGGCCTGTGGCATATTCATCCAGAGCAACAGCATGCCCGTCTACGTGAGGTGGCTGAAATGGGTCACTTAC
ACCTTCTACGCCTTCGGAGCATATGTTTCCAACGAATTCCGGGGCAGTTTCTACGATTGCCCCGATCCGGCTGGT
CCATCGAGTCCTGCCTGCGTACAGTATTCCGGCGACTACGTGATAGAGTCTCTCGGCTTCCCGCGGAACTGGATT
CTGCGTCCCATACTCGCCATGCTAGCCTTCGTCGTCTTCTTCTGCGCCCTCTCCACGCTCGGTTTGTACCTCTTC
AAGCCCGGAATGGCCATTGCTCGCTCTCGGACCGCAGATACCGACTTGTCTGCCGGTAAGGAGAAGCCGATGGCT
TACTGTATCGAGAAGGTCCGCACAATCGACTTGGGGCTTGATCAGTTTTGCCTGGCCCTGGACAAGCGATCCATC
TCCGGCAAGAAGCTGCCCCGGAAGACGATTTTGAACCCCGTCAATGCGACCTTTGAAGCTGGCGTCTTGAACGTC
ATCATGGGCCCCTCGGGCAGCGGCAAGACGTCACTCCTTAACGCGATGGCGCTGCGACTTCGCAACTCTGCAGGC
AGCAGATACCGGCCGTACGGAAAGCTCACCTTTAACGGGGCCGTGCCCTCCGACTCGGTCATCCGCTCCGTCTGC
TCCTATGTCTGCCAGGACGATGACGCGCTGCTGCCATCGCTGACGGTCCGGGAGACGCTGCGATTCGCGGCCGGC
CTTCGTCTGCCCTCTTCCATGAGCAGGGCGGAAAAGAACCGGCGTGCCGACGAGGTGTTGATGAGGATGGGTCTG
AAAGACTGCGCGAACACGCTGATTGGGAGCGAGCTGATCAGGGGCATTTCGGGCGGGGAAAAGCGTCGTGTCTCC
ATCGCCGTCCAAATCCTGACCGATCCTCGGATCCTCCTGCTCGATGAGCCGACCTCGGGTCTGGATGCGTTCACA
GCCAGCTCGATTATGGAAGTATTGAAAGGGCTGGCAAGCGAGGGCCGCACGCTCGTCCTGACCATCCACCAGGCC
CGCTCAGACCTGTTCAGGCATTTCGGCAACGTCCTCCTGCTTGCCAGAGGAGGTTGTACCGCATTTGCAGGCCCG
GCTGCAGAGATGCTTGGACACTTCGGCAAGTATGGCTACGAATGCCCCCAGCACACGAACCCGGCAGACTTTGCC
CTCGACCTGATAACGATCGACTTGCAGCGAGACGACAGAGAGGCGACCAGTCGCGAGAGGGTTCAAAGGCTGATA
GAGGAGTGGAAAGGTCACGAAGGCAAGTCGCTCGATAAAGCCAGTCACCTTCCAGGGGGCATTGGGGAGCTTGAG
GAGTCCAGCAACGAGCCTCTTGACTCGCCAGGGGCGAAAGACACAGCGCAAGCGAAGCAGGAGATTCTGACAGGA
GAGACGGCTCGGGGCAAGTCAAGCGCGAGCCACAAGCACGGCCACGCCGGGCGAAAATCGTTCAACAAGGCCAGC
GTCTCGACGCCGGCCGAGCTGGGAGCCCTCGTCCGCAAACGGGCCTCACTCCCGGTGGCGCTGCCGCTGCTCCTG
CGGCGGGCCACCATCAATGCGCGTAGGCAGCCGGAGCTGATTCTCGCTAGGACGATGCAGGTCATCGGGCTCGCC
ATCGTCCTTGCCCTCTTCTTCGCGCCGCTGGGAAACGACTACTTCTCGGTGCAGAGCCGGATGGGGCTCGTGCAG
GAGGTCGGGGCGCTGTACTTCGTCGGCATGCTCCAGAACGTGGCCGTGTATCCGAGCGAGCGCGACGTCTTTTAC
CGCGAGGACGAGGACGGCGTATACGGCGTCGACGCCTTCCTGGCCGCCTACACCATCCTCGAGGTCCCCTTCGAG
GTCTTCAGCTGCCTGGTGTTCGGCGCCCTGGCCGTCGTCGCCGTCGGGCTGCCGCTGACGGCCACCATGTACTTC
GTCGCCGTCTTTGTCTGCTTCGGGCTCGTGTCGTGCGGCGAGAGCCTGGGCATCATGTTCAACACGCTGTTTGGC
CACACCGGTTTCGCCGTCAACATCATGGGCGTCTTCCTGGCCGTGGCGGCAGGCATGGCTGGCGTCCTGTCCATC
GACATGCCCGACCTCTTCCGTGCCGCCAACTACCTGTCGCCCGCCCGCTACGCGACCCGCGCGGTGGCGCCCTAC
TCACTCCGCGGCGTCAGCTTCACCTGTTCAGACGGCCAGCGGCTGCCGGACGGGAGCTGTCCCGTCGAAACGGGC
AGCCAGGTGCTGCAACTGTACAAGCTCGACGTCGACCCGGTGGTCAACGTGGCGGCAATGGCGGCATGCGTTGTC
GTCTACCGTCTCTTGGCCTGGGTTCTCCTGAGAGTCATGAGAGCGAGATGGAGAGACAAAAGAGCACCAACGACG
AGTGAGCTGGCGTCGGGGGGCTGA
Transcript >Hirsu2|10837
ATGGCCGGCGACGACGCTGGCGAGCCCAAGCTGGCCGAGGACGCCACCACCGCGGACGAGACGGGCTCGACGGGT
GGCTCCGTGCCCCGGTCTTCCGGGCAGCAGAAGGGGGCGCCGGCGGCGCGGCAGCTTTCGCTGTCCGGCGACGAC
AATCTCTCGCTCGACGATGTCGAGCCCGTGCGCGTCAGCATCCGCGACCTCTCCGTCTCGGTCGACCTGGCGCCG
TCCTGGCGCGAGCCGTCGACGTACGCCGACGCGCTGCTGGCCGCGCGGGGCGGCGGGCCCGACGGCGCCGGGCCG
GGCCGCACCAAGACGCTGCTGGACTCGGTCGCGGCCGACCTGCCGCCCGGTTCGCTCACGGCCATCGTCGGTGGC
AGCGGCTCCGGCAAGACGACGCTCCTCAACACGCTGGCCGAGAGGGCGGCCGGCTCGAGGCTGAGCCGGGCCGGC
TGCGTGACCTTCAACGGCCGGCCGGGCGTGCAGGCCGTCCGGCACGCCTACGTCATGCAGCAGGACGTCCTCCTG
CCGACCCTGACCGTCCGGGAGACGCTTCGGTACGCAGCCGAGCTGCGGCTGCCGGCCGCGACCTCGGCCCGCGAC
CGCGCCCGCGTCGTCGACGAGGTCATCCGCGAGCTCGGCCTCAAGGAGTGCGCCGACACGCGCATCGGCAGCAGC
CGGCACCGCGGCTGCTCCGGCGGCGAGAAGCGGCGCGTGAGCATCGGGGTCCAGCTGCTGGCGAACCCGTCGGTG
CTGTTCCTCGACGAGCCCACGACGGGCCTCGACGCCACGAGCGCCTTCCAGCTCGTACGGGGCCTCAAGAACCTG
GCCCGGAAGGGACGGACCATCGTCACGACCATTCACCAGCCGCGGTCCGAGATATGGCACCTCTTCGACGGCCTG
GTCGTCTTGTCCAGGGGCGGGCCGGTCTACTCCGGCCCCATGCGCGACTGTGCTCCCTGGTTCGAGGCCCGGGGC
TTTGCACTGCCCCCTTTCGTCAACCCGGCCGAGCACATCGTCGACATCGCCGCTGTGGACAGCCGGACGCCCGAG
CTGGAGGAGGAGAGCAGCGCGCGTGTCGAGGGCCTCAGGACCGCCTGGCGCTTGGCGAGCGCTTCGCGATTTGAG
CCCGTCTCCGCAGACGTCGGCGCCCGGCCGAAGAGGCGTGTCTCCGGAGCTGCCGCCGCCCGCGCAGGCTTCTTC
CGCCAGCTCCTCGTCCTGACCGGCCGCACGTTCAAGGTGACGCGTCGAGACCCGCTCGGCATGGCGGCCTGTATA
CTCGAAGCCGTCTTCATGGGCCTCACCGTCGGCTACCTGTTTTTCGACCTCGGGCGCGACTTGTCCGCCATCCGC
TCGCGGGAAGGCGGCCTGTACTATGCCGCCGCCCTGCAGGGATATCTGATTCTCATCTTCGAAGTGTATCGGATG
ACCATCGACATCGCCACCTTCGACCGCGAGTCGTCCGACAACTGTGTCGACCCGCTCCCGTTCGTTCTCTCTCGT
CGCCTAGCGCGGATACCCATCGAGGACGTGCCGGTGCCCCTGATCTTTTCCGCCCTGTCATATTTCCTGGCTGGC
TTTGACCGTCAGGTGGACAAGTTCTTCATCTACTTCGCCGTCACCCTCGTCAATCAGTTCATTGCCGTGACGTGC
GCCATGACTTGCGTCGTCGCCGTCAGGCACTTTGCCGGCGCCAGCCTGATGGCGAACCTGGTCTTCACCTTGCAG
TCCCTGGCCTGTGGCATATTCATCCAGAGCAACAGCATGCCCGTCTACGTGAGGTGGCTGAAATGGGTCACTTAC
ACCTTCTACGCCTTCGGAGCATATGTTTCCAACGAATTCCGGGGCAGTTTCTACGATTGCCCCGATCCGGCTGGT
CCATCGAGTCCTGCCTGCGTACAGTATTCCGGCGACTACGTGATAGAGTCTCTCGGCTTCCCGCGGAACTGGATT
CTGCGTCCCATACTCGCCATGCTAGCCTTCGTCGTCTTCTTCTGCGCCCTCTCCACGCTCGGTTTGTACCTCTTC
AAGCCCGGAATGGCCATTGCTCGCTCTCGGACCGCAGATACCGACTTGTCTGCCGGTAAGGAGAAGCCGATGGCT
TACTGTATCGAGAAGGTCCGCACAATCGACTTGGGGCTTGATCAGTTTTGCCTGGCCCTGGACAAGCGATCCATC
TCCGGCAAGAAGCTGCCCCGGAAGACGATTTTGAACCCCGTCAATGCGACCTTTGAAGCTGGCGTCTTGAACGTC
ATCATGGGCCCCTCGGGCAGCGGCAAGACGTCACTCCTTAACGCGATGGCGCTGCGACTTCGCAACTCTGCAGGC
AGCAGATACCGGCCGTACGGAAAGCTCACCTTTAACGGGGCCGTGCCCTCCGACTCGGTCATCCGCTCCGTCTGC
TCCTATGTCTGCCAGGACGATGACGCGCTGCTGCCATCGCTGACGGTCCGGGAGACGCTGCGATTCGCGGCCGGC
CTTCGTCTGCCCTCTTCCATGAGCAGGGCGGAAAAGAACCGGCGTGCCGACGAGGTGTTGATGAGGATGGGTCTG
AAAGACTGCGCGAACACGCTGATTGGGAGCGAGCTGATCAGGGGCATTTCGGGCGGGGAAAAGCGTCGTGTCTCC
ATCGCCGTCCAAATCCTGACCGATCCTCGGATCCTCCTGCTCGATGAGCCGACCTCGGGTCTGGATGCGTTCACA
GCCAGCTCGATTATGGAAGTATTGAAAGGGCTGGCAAGCGAGGGCCGCACGCTCGTCCTGACCATCCACCAGGCC
CGCTCAGACCTGTTCAGGCATTTCGGCAACGTCCTCCTGCTTGCCAGAGGAGGTTGTACCGCATTTGCAGGCCCG
GCTGCAGAGATGCTTGGACACTTCGGCAAGTATGGCTACGAATGCCCCCAGCACACGAACCCGGCAGACTTTGCC
CTCGACCTGATAACGATCGACTTGCAGCGAGACGACAGAGAGGCGACCAGTCGCGAGAGGGTTCAAAGGCTGATA
GAGGAGTGGAAAGGTCACGAAGGCAAGTCGCTCGATAAAGCCAGTCACCTTCCAGGGGGCATTGGGGAGCTTGAG
GAGTCCAGCAACGAGCCTCTTGACTCGCCAGGGGCGAAAGACACAGCGCAAGCGAAGCAGGAGATTCTGACAGGA
GAGACGGCTCGGGGCAAGTCAAGCGCGAGCCACAAGCACGGCCACGCCGGGCGAAAATCGTTCAACAAGGCCAGC
GTCTCGACGCCGGCCGAGCTGGGAGCCCTCGTCCGCAAACGGGCCTCACTCCCGGTGGCGCTGCCGCTGCTCCTG
CGGCGGGCCACCATCAATGCGCGTAGGCAGCCGGAGCTGATTCTCGCTAGGACGATGCAGGTCATCGGGCTCGCC
ATCGTCCTTGCCCTCTTCTTCGCGCCGCTGGGAAACGACTACTTCTCGGTGCAGAGCCGGATGGGGCTCGTGCAG
GAGGTCGGGGCGCTGTACTTCGTCGGCATGCTCCAGAACGTGGCCGTGTATCCGAGCGAGCGCGACGTCTTTTAC
CGCGAGGACGAGGACGGCGTATACGGCGTCGACGCCTTCCTGGCCGCCTACACCATCCTCGAGGTCCCCTTCGAG
GTCTTCAGCTGCCTGGTGTTCGGCGCCCTGGCCGTCGTCGCCGTCGGGCTGCCGCTGACGGCCACCATGTACTTC
GTCGCCGTCTTTGTCTGCTTCGGGCTCGTGTCGTGCGGCGAGAGCCTGGGCATCATGTTCAACACGCTGTTTGGC
CACACCGGTTTCGCCGTCAACATCATGGGCGTCTTCCTGGCCGTGGCGGCAGGCATGGCTGGCGTCCTGTCCATC
GACATGCCCGACCTCTTCCGTGCCGCCAACTACCTGTCGCCCGCCCGCTACGCGACCCGCGCGGTGGCGCCCTAC
TCACTCCGCGGCGTCAGCTTCACCTGTTCAGACGGCCAGCGGCTGCCGGACGGGAGCTGTCCCGTCGAAACGGGC
AGCCAGGTGCTGCAACTGTACAAGCTCGACGTCGACCCGGTGGTCAACGTGGCGGCAATGGCGGCATGCGTTGTC
GTCTACCGTCTCTTGGCCTGGGTTCTCCTGAGAGTCATGAGAGCGAGATGGAGAGACAAAAGAGCACCAACGACG
AGTGAGCTGGCGTCGGGGGGCTGA
Gene >Hirsu2|10837
ATGGCCGGCGACGACGCTGGCGAGCCCAAGCTGGCCGAGGACGCCACCACCGCGGACGAGACGGGCTCGACGGGT
GGCTCCGTGCCCCGGTCTTCCGGGCAGCAGAAGGGGGCGCCGGCGGCGCGGCAGCTTTCGCTGTCCGGCGACGAC
AATCTCTCGCTCGACGATGTCGAGCCCGTGCGCGTCAGCATCCGCGACCTCTCCGTCTCGGTCGACCTGGCGCCG
TCCTGGCGCGAGCCGTCGACGTACGCCGACGCGCTGCTGGCCGCGCGGGGCGGCGGGCCCGACGGCGCCGGGCCG
GGCCGCACCAAGACGCTGCTGGACTCGGTCGCGGCCGACCTGCCGCCCGGTTCGCTCACGGCCATCGTCGGTGGC
AGCGGCTCCGGCAAGACGACGCTCCTCAACACGCTGGCCGAGAGGGCGGCCGGCTCGAGGCTGAGCCGGGCCGGC
TGCGTGACCTTCAACGGCCGGCCGGGCGTGCAGGCCGTCCGGCACGCCTACGTCATGCAGCAGGACGTCCTCCTG
CCGACCCTGACCGTCCGGGAGACGCTTCGGTACGCAGCCGAGCTGCGGCTGCCGGCCGCGACCTCGGCCCGCGAC
CGCGCCCGCGTCGTCGACGAGGTCATCCGCGAGCTCGGCCTCAAGGAGTGCGCCGACACGCGCATCGGCAGCAGC
CGGCACCGCGGCTGCTCCGGCGGCGAGAAGCGGCGCGTGAGCATCGGGGTCCAGCTGCTGGCGAACCCGTCGGTG
CTGTTCCTCGACGAGCCCACGACGGGCCTCGACGCCACGAGCGCCTTCCAGCTCGTACGGGGCCTCAAGAACCTG
GCCCGGAAGGGACGGACCATCGTCACGACCATTCACCAGCCGCGGTCCGAGATATGGCACCTCTTCGACGGCCTG
GTCGTCTTGTCCAGGGGCGGGCCGGTCTACTCCGGCCCCATGCGCGACTGTGCTCCCTGGTTCGAGGCCCGGGGC
TTTGCACTGCCCCCTTTCGTCAACCCGGCCGAGCACATCGTCGACATCGCCGCTGTGGACAGCCGGACGCCCGAG
CTGGAGGAGGAGAGCAGCGCGCGTGTCGAGGGCCTCAGGACCGCCTGGCGCTTGGCGAGCGCTTCGCGATTTGAG
CCCGTCTCCGCAGACGTCGGCGCCCGGCCGAAGAGGCGTGTCTCCGGAGCTGCCGCCGCCCGCGCAGGCTTCTTC
CGCCAGCTCCTCGTCCTGACCGGCCGCACGTTCAAGGTGACGCGTCGAGACCCGCTCGGCATGGCGGCCTGTATA
CTCGAAGCCGTCTTCATGGGCCTCACCGTCGGCTACCTGTTTTTCGACCTCGGGCGCGACTTGTCCGCCATCCGC
TCGCGGGAAGGCGGCCTGTACTATGCCGCCGCCCTGCAGGGATATCTGATTCTCATCTTCGAAGTGTATCGGATG
ACCATCGACATCGCCACCTTCGACCGCGAGTCGTCCGACAACTGTGTCGACCCGCTCCCGTTCGTTCTCTCTCGT
CGCCTAGCGCGGATACCCATCGAGGACGTGCCGGTGCCCCTGATCTTTTCCGCCCTGTCATATTTCCTGGCTGGC
TTTGACCGTCAGGTGGACAAGTTCTTCATCTACTTCGCCGTCACCCTCGTCAATCAGTTCATTGCCGTGACGTGC
GCCATGACTTGCGTCGTCGCCGTCAGGCACTTTGCCGGCGCCAGCCTGATGGCGAACCTGGTCTTCACCTTGCAG
TCCCTGGCCTGTGGCATATTCATCCAGAGCAACAGCATGCCCGTCTACGTGAGGTGGCTGAAATGGGTCACTTAC
ACCGTGAGCCTCCCTTCCATCCAGTTGCGCGCTGCCGCTGCAGCATGACCTGACTCGGGCCAGTTCTACGCCTTC
GGAGCATATGTTTCCAACGAATTCCGGGGCAGTTTCTACGATTGCCCCGATCCGGCTGGTCCATCGAGTCCTGCC
TGCGTACAGTATTCCGGCGACTACGTGATAGAGTCTCTCGGCTTCCCGCGGAACTGGATTCTGCGTCCCATACTC
GCCATGCTAGCCTTCGTCGTCTTCTTCTGCGCCCTCTCCACGCTCGGTTTGTACCTCTTCAAGCCCGGAATGGCC
ATTGCTCGCTCTCGGACCGCAGATACCGACTTGTCTGCCGGTAAGGAGAAGCCGATGGCTTACTGTATCGAGAAG
GTCCGCACAATCGACTTGGGGCTTGATCAGTTTTGCCTGGCCCTGGACAAGCGATCCATCTCCGGCAAGAAGCTG
CCCCGGAAGACGATTTTGAACCCCGTCAATGCGACCTTTGAAGCTGGCGTCTTGAACGTCATCATGGGCCCCTCG
GGCAGCGGCAAGACGTCACTCCTTAACGCGATGGCGCTGCGACTTCGCAACTCTGCAGGCAGCAGATACCGGCCG
TACGGAAAGCTCACCTTTAACGGGGCCGTGCCCTCCGACTCGGTCATCCGCTCCGTCTGCTCCTATGTCTGCCAG
GACGATGACGCGCTGCTGCCATCGCTGACGGTCCGGGAGACGCTGCGATTCGCGGCCGGCCTTCGTCTGCCCTCT
TCCATGAGCAGGGCGGAAAAGAACCGGCGTGCCGACGAGGTGTTGATGAGGATGGGTCTGAAAGACTGCGCGAAC
ACGCTGATTGGGAGCGAGCTGATCAGGGGCATTTCGGGCGGGGAAAAGCGTCGTGTCTCCATCGCCGTCCAAATC
CTGACCGATCCTCGGATCCTCCTGCTCGATGAGCCGACCTCGGGTCTGGATGCGTTCACAGCCAGCTCGATTATG
GAAGTATTGAAAGGGCTGGCAAGCGAGGGCCGCACGCTCGTCCTGACCATCCACCAGGCCCGCTCAGACCTGTTC
AGGCATTTCGGCAACGTCCTCCTGCTTGCCAGAGGAGGTTGTACCGCATTTGCAGGCCCGGCTGCAGAGATGCTT
GGACACTTCGGCAAGTATGGCTACGAATGCCCCCAGCACACGAACCCGGCAGACTTTGCCCTCGACCTGATAACG
ATCGACTTGCAGCGAGACGACAGAGAGGCGACCAGTCGCGAGAGGGTTCAAAGGCTGATAGAGGAGTGGAAAGGT
CACGAAGGCAAGTCGCTCGATAAAGCCAGTCACCTTCCAGGGGGCATTGGGGAGCTTGAGGAGTCCAGCAACGAG
CCTCTTGACTCGCCAGGGGCGAAAGACACAGCGCAAGCGAAGCAGGAGATTCTGACAGGAGAGACGGCTCGGGGC
AAGTCAAGCGCGAGCCACAAGCACGGCCACGCCGGGCGAAAATCGTTCAACAAGGCCAGCGTCTCGACGCCGGCC
GAGCTGGGAGCCCTCGTCCGCAAACGGGCCTCACTCCCGGTGGCGCTGCCGCTGCTCCTGCGGCGGGCCACCATC
AATGCGCGTAGGCAGCCGGAGCTGATTCTCGCTAGGACGATGCAGGTCATCGGGCTCGCCATCGTCCTTGCCCTC
TTCTTCGCGCCGCTGGGAAACGACTACTTCTCGGTGCAGAGCCGGATGGGGCTCGTGCAGGAGGTCGGGGCGCTG
TACTTCGTCGGCATGCTCCAGAACGTGGCCGTGTATCCGAGCGAGCGCGACGTCTTTTACCGCGAGGACGAGGAC
GGCGTATACGGCGTCGACGCCTTCCTGGCCGCCTACACCATCCTCGAGGTCCCCTTCGAGGTCTTCAGCTGCCTG
GTGTTCGGCGCCCTGGCCGTCGTCGCCGTCGGGCTGCCGCTGACGGCCACCATGTACTTCGTCGCCGTCTTTGTC
TGCTTCGGGCTCGTGTCGTGCGGCGAGAGCCTGGGCATCATGTTCAACACGCTGTTTGGCCACACCGGTTTCGCC
GTCAACATCATGGGCGTCTTCCTGGCCGTGGCGGCAGGCATGGCTGGCGTCCTGTCCATCGACATGCCCGACCTC
TTCCGTGCCGCCAACTACCTGTCGCCCGCCCGCTACGCGACCCGCGCGGTGGCGCCCTACTCACTCCGCGGCGTC
AGCTTCACCTGTTCAGACGGCCAGCGGCTGCCGGACGGGAGCTGTCCCGTCGAAACGGGCAGCCAGGTGCTGCAA
CTGTACAAGCTCGACGTCGACCCGGTGGTCAACGTGGCGGCAATGGCGGCATGCGTTGTCGTCTACCGTCTCTTG
GCCTGGGTTCTCCTGAGAGTCATGAGAGCGAGATGGAGAGACAAAAGAGCACCAACGACGAGTGAGCTGGCGTCG
GGGGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail