Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10836
Gene name
LocationContig_910:729..1844
Strand-
Gene length (bp)1115
Transcript length (bp)987
Coding sequence length (bp)987
Protein length (aa) 329

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11338 DUF3140 Protein of unknown function (DUF3140) 4.2E-35 10 113
PF11160 Hva1_TUDOR Hypervirulence associated proteins TUDOR domain 3.6E-14 264 325

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10836
MKDQGTVIEEFNGIVNMTASELESWLKSEDSQSAGWPKEDEGGESVGHDSGRKIVAILESNPDKDPEKYTEDQIQ
HMRKVVSYCKRHLAQEEKANDEKPIEEVKKTKSFASLKNWGHDPLKKRTGSDQDNGDEDKENGQGEKQAGDKRKA
ADGDSGANKKRQTEKGKSTTTKDEEEKENEKDQAKASNGAKKSNGAKDKEKTDGEEDAKAEADEEKEQGEDEAVD
EEEEGADGEDEASDEKEAAKEEADDGEKSGKPAKGPNVGDTVSWNWGNGQPEGKVLDVKADKATIETKRGNEVSR
NGDAEDPAVVIDTGKSKAVKSAHELNES*
Coding >Hirsu2|10836
ATGAAGGACCAAGGAACCGTCATTGAAGAGTTCAATGGCATTGTCAACATGACGGCGTCTGAGCTCGAGAGCTGG
CTCAAGTCGGAAGACTCACAGAGCGCCGGATGGCCCAAGGAGGACGAAGGCGGAGAATCCGTCGGCCATGACAGC
GGCCGCAAGATCGTGGCCATACTCGAGTCTAACCCGGACAAGGACCCCGAAAAGTACACGGAGGACCAGATCCAG
CACATGCGCAAGGTCGTATCCTACTGCAAGAGACATCTCGCCCAAGAGGAAAAGGCGAACGACGAAAAGCCAATC
GAGGAAGTGAAGAAGACCAAGTCATTTGCATCGCTCAAGAACTGGGGCCACGACCCTCTCAAGAAGCGCACCGGT
AGCGATCAAGATAATGGAGACGAGGACAAGGAGAATGGGCAGGGCGAAAAGCAGGCCGGGGACAAGAGGAAAGCG
GCCGATGGCGATTCCGGCGCCAACAAAAAGAGACAGACGGAGAAGGGAAAGTCGACCACCACCAAGGACGAGGAA
GAGAAGGAGAACGAGAAAGACCAGGCCAAGGCCTCCAATGGTGCGAAAAAGTCGAATGGGGCCAAGGACAAAGAG
AAGACGGATGGCGAAGAGGACGCCAAGGCGGAGGCGGACGAGGAAAAAGAACAAGGAGAGGATGAGGCTGTCGAC
GAGGAGGAGGAAGGGGCAGACGGAGAAGACGAGGCAAGCGACGAGAAGGAGGCAGCGAAGGAGGAAGCGGACGAC
GGCGAAAAGTCTGGGAAGCCGGCAAAGGGACCCAACGTCGGTGATACAGTGAGCTGGAACTGGGGCAACGGCCAG
CCGGAGGGCAAAGTCCTCGACGTCAAGGCCGACAAGGCGACGATCGAGACGAAGCGAGGCAACGAAGTGAGCCGG
AATGGTGACGCCGAGGATCCAGCTGTTGTCATCGACACGGGCAAGTCGAAGGCCGTCAAGTCGGCTCACGAGCTG
AATGAGTCGTGA
Transcript >Hirsu2|10836
ATGAAGGACCAAGGAACCGTCATTGAAGAGTTCAATGGCATTGTCAACATGACGGCGTCTGAGCTCGAGAGCTGG
CTCAAGTCGGAAGACTCACAGAGCGCCGGATGGCCCAAGGAGGACGAAGGCGGAGAATCCGTCGGCCATGACAGC
GGCCGCAAGATCGTGGCCATACTCGAGTCTAACCCGGACAAGGACCCCGAAAAGTACACGGAGGACCAGATCCAG
CACATGCGCAAGGTCGTATCCTACTGCAAGAGACATCTCGCCCAAGAGGAAAAGGCGAACGACGAAAAGCCAATC
GAGGAAGTGAAGAAGACCAAGTCATTTGCATCGCTCAAGAACTGGGGCCACGACCCTCTCAAGAAGCGCACCGGT
AGCGATCAAGATAATGGAGACGAGGACAAGGAGAATGGGCAGGGCGAAAAGCAGGCCGGGGACAAGAGGAAAGCG
GCCGATGGCGATTCCGGCGCCAACAAAAAGAGACAGACGGAGAAGGGAAAGTCGACCACCACCAAGGACGAGGAA
GAGAAGGAGAACGAGAAAGACCAGGCCAAGGCCTCCAATGGTGCGAAAAAGTCGAATGGGGCCAAGGACAAAGAG
AAGACGGATGGCGAAGAGGACGCCAAGGCGGAGGCGGACGAGGAAAAAGAACAAGGAGAGGATGAGGCTGTCGAC
GAGGAGGAGGAAGGGGCAGACGGAGAAGACGAGGCAAGCGACGAGAAGGAGGCAGCGAAGGAGGAAGCGGACGAC
GGCGAAAAGTCTGGGAAGCCGGCAAAGGGACCCAACGTCGGTGATACAGTGAGCTGGAACTGGGGCAACGGCCAG
CCGGAGGGCAAAGTCCTCGACGTCAAGGCCGACAAGGCGACGATCGAGACGAAGCGAGGCAACGAAGTGAGCCGG
AATGGTGACGCCGAGGATCCAGCTGTTGTCATCGACACGGGCAAGTCGAAGGCCGTCAAGTCGGCTCACGAGCTG
AATGAGTCGTGA
Gene >Hirsu2|10836
ATGAAGGACCAAGGAACCGTCATTGAAGAGTTCAATGGCATTGTCAACATGACGGCGTCTGAGCTCGAGAGCTGG
CTCAAGTCGGAAGACTCACAGAGCGCCGGATGGCCCAAGGAGGACGAAGGCGGAGAATCCGTCGGCCATGACAGC
GGCCGCAAGATCGTGGCCATACTCGAGTCTAACCCGGACAAGGACCCCGAAAAGTACACGGAGGACCAGATCCAG
CACATGCGCAAGGTCGTATCCTACTGGTAAGTGTGTGCGCGCGTGCCCTGCGTTCGTCAGCTGGCTTTCGTCTCG
ACTCACCGTCACGGCCCCATGACAGCAAGAGACATCTCGCCCAAGAGGAAAAGGCGAACGACGAAAAGCCAATCG
AGGAAGTGAAGAAGACCAAGTCATTTGCATCGCTCAAGAACTGGGGCCACGACCCTCTCAAGAAGCGCACCGGTA
GCGATCAAGATAATGGAGACGAGGACAAGGAGAATGGGCAGGGCGAAAAGCAGGCCGGGGACAAGAGGAAAGCGG
CCGATGGCGATTCCGGCGCCAACAAAAAGAGACAGACGGAGAAGGGAAAGTCGACCACCACCAAGGACGAGGAAG
AGAAGGAGAACGAGAAAGACCAGGCCAAGGCCTCCAATGGTGCGAAAAAGTCGAATGGGGCCAAGGACAAAGAGA
AGACGGATGGCGAAGAGGACGCCAAGGCGGAGGCGGACGAGGAAAAAGAACAAGGAGAGGATGAGGCTGTCGACG
AGGAGGAGGAAGGGGCAGACGGAGAAGACGAGGCAAGCGACGAGAAGGAGGCAGCGAAGGAGGAAGCGGACGACG
GCGAAAAGTCTGGGAAGCCGGCAAAGGGACCCAACGTCGGTGATACAGTGAGCTGGAACTGGGGCAACGGCCAGC
CGGAGGGCAAAGTCCTCGACGTCAAGGCCGACAAGTAAGCCGATTTCCCAGGTTCGGTGTCAGTGGACGCGCAGC
TGACTGCAGGCAGGGCGACGATCGAGACGAAGCGAGGCAACGAAGTGAGCCGGAATGGTGACGCCGAGGATCCAG
CTGTTGTCATCGACACGGGCAAGTCGAAGGCCGTCAAGTCGGCTCACGAGCTGAATGAGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail