Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10832
Gene name
LocationContig_91:31758..32975
Strand-
Gene length (bp)1217
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00398 RrnaAD Ribosomal RNA adenine dimethylase 1.5E-63 36 261
PF13649 Methyltransf_25 Methyltransferase domain 2.1E-06 68 137
PF08241 Methyltransf_11 Methyltransferase domain 4.1E-05 69 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41819|DIM1_YEAST Dimethyladenosine transferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIM1 PE=3 SV=1 1 381 2.0E-138
sp|Q6BSY5|DIM1_DEBHA Dimethyladenosine transferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DIM1 PE=3 SV=1 20 381 3.0E-138
sp|Q75C90|DIM1_ASHGO Dimethyladenosine transferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DIM1 PE=3 SV=1 24 381 1.0E-135
sp|Q6FKY3|DIM1_CANGA Dimethyladenosine transferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DIM1 PE=3 SV=1 1 381 3.0E-135
sp|P78697|DIM1_KLULA Dimethyladenosine transferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DIM1 PE=3 SV=3 1 381 3.0E-133
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41819|DIM1_YEAST Dimethyladenosine transferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIM1 PE=3 SV=1 1 381 2.0E-138
sp|Q6BSY5|DIM1_DEBHA Dimethyladenosine transferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DIM1 PE=3 SV=1 20 381 3.0E-138
sp|Q75C90|DIM1_ASHGO Dimethyladenosine transferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DIM1 PE=3 SV=1 24 381 1.0E-135
sp|Q6FKY3|DIM1_CANGA Dimethyladenosine transferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DIM1 PE=3 SV=1 1 381 3.0E-135
sp|P78697|DIM1_KLULA Dimethyladenosine transferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DIM1 PE=3 SV=3 1 381 3.0E-133
sp|Q6C7H6|DIM1_YARLI Dimethyladenosine transferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DIM1 PE=3 SV=1 1 381 2.0E-131
sp|Q9USU2|DIM1_SCHPO Dimethyladenosine transferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dim1 PE=3 SV=1 19 285 9.0E-121
sp|Q9UNQ2|DIM1_HUMAN Probable dimethyladenosine transferase OS=Homo sapiens GN=DIMT1 PE=1 SV=1 38 308 9.0E-107
sp|Q2KHT8|DIM1_BOVIN Probable dimethyladenosine transferase OS=Bos taurus GN=DIMT1 PE=2 SV=1 38 308 7.0E-106
sp|Q9D0D4|DIM1_MOUSE Probable dimethyladenosine transferase OS=Mus musculus GN=Dimt1 PE=2 SV=1 38 308 8.0E-106
sp|Q95KJ0|DIM1_MACFA Probable dimethyladenosine transferase OS=Macaca fascicularis GN=DIMT1 PE=2 SV=1 38 308 9.0E-106
sp|O22268|DIM1A_ARATH Ribosomal RNA small subunit methyltransferase OS=Arabidopsis thaliana GN=DIM1A PE=1 SV=1 20 381 3.0E-102
sp|Q54QK7|DIM1_DICDI Probable dimethyladenosine transferase OS=Dictyostelium discoideum GN=dimt1 PE=3 SV=1 24 380 1.0E-101
sp|Q9VAQ5|DIM1_DROME Probable dimethyladenosine transferase OS=Drosophila melanogaster GN=CG11837 PE=2 SV=1 38 308 4.0E-99
sp|Q09522|DIM1_CAEEL Probable dimethyladenosine transferase OS=Caenorhabditis elegans GN=E02H1.1 PE=3 SV=2 26 308 2.0E-91
sp|Q9FK02|DIM1B_ARATH Ribosomal RNA small subunit methyltransferase, mitochondrial OS=Arabidopsis thaliana GN=DIM1B PE=1 SV=1 43 380 3.0E-65
sp|Q9V1P8|RSMA_PYRAB Probable ribosomal RNA small subunit methyltransferase A OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rsmA PE=3 SV=1 39 258 2.0E-41
sp|Q8PU18|RSMA_METMA Probable ribosomal RNA small subunit methyltransferase A OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rsmA PE=3 SV=2 37 261 4.0E-41
sp|Q8TQU8|RSMA_METAC Probable ribosomal RNA small subunit methyltransferase A OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rsmA PE=3 SV=1 37 261 4.0E-41
sp|Q12XH7|RSMA_METBU Probable ribosomal RNA small subunit methyltransferase A OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rsmA PE=3 SV=1 44 259 9.0E-40
sp|Q466S6|RSMA_METBF Probable ribosomal RNA small subunit methyltransferase A OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rsmA PE=3 SV=1 25 261 9.0E-39
sp|Q8TWU7|RSMA_METKA Probable ribosomal RNA small subunit methyltransferase A OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rsmA PE=3 SV=1 42 253 1.0E-38
sp|C5A594|RSMA_THEGJ Probable ribosomal RNA small subunit methyltransferase A OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rsmA PE=3 SV=1 35 271 7.0E-37
sp|O59487|RSMA_PYRHO Probable ribosomal RNA small subunit methyltransferase A OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rsmA PE=3 SV=2 41 248 5.0E-35
sp|Q5JI54|RSMA_THEKO Probable ribosomal RNA small subunit methyltransferase A OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rsmA PE=3 SV=1 35 261 5.0E-35
sp|Q3IPM0|RSMA_NATPD Probable ribosomal RNA small subunit methyltransferase A OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rsmA PE=3 SV=1 44 258 5.0E-35
sp|B6YTK7|RSMA_THEON Probable ribosomal RNA small subunit methyltransferase A OS=Thermococcus onnurineus (strain NA1) GN=rsmA PE=3 SV=1 39 268 7.0E-34
sp|C6A222|RSMA_THESM Probable ribosomal RNA small subunit methyltransferase A OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rsmA PE=3 SV=1 39 269 4.0E-33
sp|Q8TH24|RSMA_PYRFU Probable ribosomal RNA small subunit methyltransferase A OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rsmA PE=3 SV=1 42 268 6.0E-33
sp|Q2NE42|RSMA_METST Probable ribosomal RNA small subunit methyltransferase A OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rsmA PE=3 SV=1 36 255 3.0E-32
sp|O27381|RSMA_METTH Probable ribosomal RNA small subunit methyltransferase A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rsmA PE=3 SV=1 37 252 4.0E-32
sp|Q18GB5|RSMA_HALWD Probable ribosomal RNA small subunit methyltransferase A OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rsmA PE=3 SV=1 41 258 5.0E-32
sp|B4RBS4|RSMA_PHEZH Ribosomal RNA small subunit methyltransferase A OS=Phenylobacterium zucineum (strain HLK1) GN=rsmA PE=3 SV=1 43 251 9.0E-32
sp|Q2FSA9|RSMA_METHJ Probable ribosomal RNA small subunit methyltransferase A OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rsmA PE=3 SV=1 44 252 1.0E-31
sp|A4QCP0|RSMA_CORGB Ribosomal RNA small subunit methyltransferase A OS=Corynebacterium glutamicum (strain R) GN=rsmA PE=3 SV=1 18 254 1.0E-31
sp|Q8EU92|RSMA_MYCPE Ribosomal RNA small subunit methyltransferase A OS=Mycoplasma penetrans (strain HF-2) GN=rsmA PE=3 SV=1 32 248 2.0E-31
sp|A6UTZ1|RSMA_META3 Probable ribosomal RNA small subunit methyltransferase A OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rsmA PE=3 SV=1 39 261 3.0E-31
sp|Q8NRY1|RSMA_CORGL Ribosomal RNA small subunit methyltransferase A OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rsmA PE=3 SV=1 18 254 9.0E-31
sp|Q9HQH1|RSMA_HALSA Probable ribosomal RNA small subunit methyltransferase A OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rsmA PE=3 SV=1 39 258 2.0E-30
sp|B0R506|RSMA_HALS3 Probable ribosomal RNA small subunit methyltransferase A OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rsmA PE=3 SV=1 39 258 2.0E-30
sp|Q5V588|RSMA_HALMA Probable ribosomal RNA small subunit methyltransferase A OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rsmA PE=3 SV=1 30 258 3.0E-30
sp|Q7NJ41|RSMA_GLOVI Ribosomal RNA small subunit methyltransferase A OS=Gloeobacter violaceus (strain PCC 7421) GN=rsmA PE=3 SV=1 43 260 4.0E-30
sp|C5CS95|RSMA_VARPS Ribosomal RNA small subunit methyltransferase A OS=Variovorax paradoxus (strain S110) GN=rsmA PE=3 SV=1 43 253 6.0E-30
sp|Q8FQZ5|RSMA_COREF Ribosomal RNA small subunit methyltransferase A OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rsmA PE=3 SV=1 18 254 8.0E-30
sp|Q4K4X5|RSMA_PSEF5 Ribosomal RNA small subunit methyltransferase A OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rsmA PE=3 SV=1 43 249 8.0E-30
sp|Q31F24|RSMA_THICR Ribosomal RNA small subunit methyltransferase A OS=Thiomicrospira crunogena (strain XCL-2) GN=rsmA PE=3 SV=1 43 254 1.0E-29
sp|A1U6F8|RSMA_MARHV Ribosomal RNA small subunit methyltransferase A OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rsmA PE=3 SV=1 43 309 2.0E-29
sp|Q58435|RSMA_METJA Probable ribosomal RNA small subunit methyltransferase A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rsmA PE=1 SV=1 35 259 2.0E-29
sp|Q3K5T2|RSMA_PSEPF Ribosomal RNA small subunit methyltransferase A OS=Pseudomonas fluorescens (strain Pf0-1) GN=rsmA PE=3 SV=1 43 263 3.0E-29
sp|Q48NT7|RSMA_PSE14 Ribosomal RNA small subunit methyltransferase A OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rsmA PE=3 SV=1 43 260 4.0E-29
sp|Q3ARC0|RSMA_CHLCH Ribosomal RNA small subunit methyltransferase A OS=Chlorobium chlorochromatii (strain CaD3) GN=rsmA PE=3 SV=1 42 248 4.0E-29
sp|A9AAW1|RSMA_METM6 Probable ribosomal RNA small subunit methyltransferase A OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rsmA PE=3 SV=1 42 266 5.0E-29
sp|A2C1Z5|RSMA_PROM1 Ribosomal RNA small subunit methyltransferase A OS=Prochlorococcus marinus (strain NATL1A) GN=rsmA PE=3 SV=1 43 279 8.0E-29
sp|Q3A3G8|RSMA_PELCD Ribosomal RNA small subunit methyltransferase A OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rsmA PE=3 SV=1 43 255 8.0E-29
sp|Q8ZTJ4|RSMA_PYRAE Probable ribosomal RNA small subunit methyltransferase A OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rsmA PE=3 SV=1 41 249 9.0E-29
sp|Q9A7N5|RSMA_CAUCR Ribosomal RNA small subunit methyltransferase A OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rsmA PE=3 SV=1 41 252 1.0E-28
sp|O28491|RSMA_ARCFU Probable ribosomal RNA small subunit methyltransferase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rsmA PE=3 SV=1 37 220 1.0E-28
sp|Q7U7D3|RSMA_SYNPX Ribosomal RNA small subunit methyltransferase A OS=Synechococcus sp. (strain WH8102) GN=rsmA PE=3 SV=1 43 249 1.0E-28
sp|A8MK56|RSMA_ALKOO Ribosomal RNA small subunit methyltransferase A OS=Alkaliphilus oremlandii (strain OhILAs) GN=rsmA PE=3 SV=1 36 248 2.0E-28
sp|Q4ZMG5|RSMA_PSEU2 Ribosomal RNA small subunit methyltransferase A OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rsmA PE=3 SV=1 43 249 2.0E-28
sp|A6VFS2|RSMA_METM7 Probable ribosomal RNA small subunit methyltransferase A OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rsmA PE=3 SV=1 42 265 3.0E-28
sp|Q6NIA2|RSMA_CORDI Ribosomal RNA small subunit methyltransferase A OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=rsmA PE=3 SV=1 42 254 3.0E-28
sp|Q9KUS2|RSMA_VIBCH Ribosomal RNA small subunit methyltransferase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rsmA PE=3 SV=2 43 257 3.0E-28
sp|A5F8N2|RSMA_VIBC3 Ribosomal RNA small subunit methyltransferase A OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rsmA PE=3 SV=1 43 257 3.0E-28
sp|Q6LYK4|RSMA_METMP Probable ribosomal RNA small subunit methyltransferase A OS=Methanococcus maripaludis (strain S2 / LL) GN=rsmA PE=3 SV=1 42 255 3.0E-28
sp|Q3ZZE6|RSMA_DEHMC Ribosomal RNA small subunit methyltransferase A OS=Dehalococcoides mccartyi (strain CBDB1) GN=rsmA PE=3 SV=1 36 248 3.0E-28
sp|Q67JB9|RSMA_SYMTH Ribosomal RNA small subunit methyltransferase A OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rsmA PE=3 SV=1 41 248 3.0E-28
sp|Q88A46|RSMA_PSESM Ribosomal RNA small subunit methyltransferase A OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rsmA PE=3 SV=1 43 260 4.0E-28
sp|A6TJK9|RSMA_ALKMQ Ribosomal RNA small subunit methyltransferase A OS=Alkaliphilus metalliredigens (strain QYMF) GN=rsmA PE=3 SV=1 36 248 4.0E-28
sp|A6VU53|RSMA_MARMS Ribosomal RNA small subunit methyltransferase A OS=Marinomonas sp. (strain MWYL1) GN=rsmA PE=3 SV=1 31 255 5.0E-28
sp|B1VUF9|RSMA_STRGG Ribosomal RNA small subunit methyltransferase A OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rsmA PE=3 SV=1 43 254 5.0E-28
sp|Q9KGK4|RSMA_BACHD Ribosomal RNA small subunit methyltransferase A OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rsmA PE=3 SV=1 36 248 5.0E-28
sp|A4FY32|RSMA_METM5 Probable ribosomal RNA small subunit methyltransferase A OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rsmA PE=3 SV=1 42 266 8.0E-28
sp|Q46L58|RSMA_PROMT Ribosomal RNA small subunit methyltransferase A OS=Prochlorococcus marinus (strain NATL2A) GN=rsmA PE=3 SV=1 43 279 9.0E-28
sp|Q2NVX6|RSMA_SODGM Ribosomal RNA small subunit methyltransferase A OS=Sodalis glossinidius (strain morsitans) GN=rsmA PE=3 SV=1 43 252 9.0E-28
sp|Q98RJ3|RSMA_MYCPU Ribosomal RNA small subunit methyltransferase A OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rsmA PE=3 SV=1 43 266 1.0E-27
sp|Q3Z9F0|RSMA_DEHM1 Ribosomal RNA small subunit methyltransferase A OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rsmA PE=3 SV=1 41 264 1.0E-27
sp|Q2JVW2|RSMA_SYNJA Ribosomal RNA small subunit methyltransferase A OS=Synechococcus sp. (strain JA-3-3Ab) GN=rsmA PE=3 SV=1 43 220 2.0E-27
sp|B1Y7L9|RSMA_LEPCP Ribosomal RNA small subunit methyltransferase A OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rsmA PE=3 SV=1 43 257 2.0E-27
sp|Q8Y219|RSMA_RALSO Ribosomal RNA small subunit methyltransferase A OS=Ralstonia solanacearum (strain GMI1000) GN=rsmA PE=3 SV=1 43 259 2.0E-27
sp|B1HS82|RSMA_LYSSC Ribosomal RNA small subunit methyltransferase A OS=Lysinibacillus sphaericus (strain C3-41) GN=rsmA PE=3 SV=1 36 248 3.0E-27
sp|B3QMU5|RSMA_CHLP8 Ribosomal RNA small subunit methyltransferase A OS=Chlorobaculum parvum (strain NCIB 8327) GN=rsmA PE=3 SV=1 42 292 3.0E-27
sp|A1BFM9|RSMA_CHLPD Ribosomal RNA small subunit methyltransferase A OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rsmA PE=3 SV=1 42 258 4.0E-27
sp|Q04C60|RSMA_LACDB Ribosomal RNA small subunit methyltransferase A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rsmA PE=3 SV=1 28 248 4.0E-27
sp|Q1GBR1|RSMA_LACDA Ribosomal RNA small subunit methyltransferase A OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rsmA PE=3 SV=1 28 248 4.0E-27
sp|Q6KH80|RSMA_MYCMO Ribosomal RNA small subunit methyltransferase A OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rsmA PE=3 SV=1 38 248 5.0E-27
sp|B7JWJ7|RSMA_CYAP8 Ribosomal RNA small subunit methyltransferase A OS=Cyanothece sp. (strain PCC 8801) GN=rsmA PE=3 SV=1 43 249 5.0E-27
sp|Q0VMV2|RSMA_ALCBS Ribosomal RNA small subunit methyltransferase A OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rsmA PE=3 SV=1 43 261 5.0E-27
sp|Q5QVN7|RSMA_IDILO Ribosomal RNA small subunit methyltransferase A OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rsmA PE=3 SV=1 43 249 7.0E-27
sp|B7GFH0|RSMA_ANOFW Ribosomal RNA small subunit methyltransferase A OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rsmA PE=3 SV=1 36 248 8.0E-27
sp|A5FS52|RSMA_DEHMB Ribosomal RNA small subunit methyltransferase A OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rsmA PE=3 SV=1 36 248 8.0E-27
sp|C1A383|RSMA_RHOE4 Ribosomal RNA small subunit methyltransferase A OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rsmA PE=3 SV=1 41 255 1.0E-26
sp|Q5L3V8|RSMA_GEOKA Ribosomal RNA small subunit methyltransferase A OS=Geobacillus kaustophilus (strain HTA426) GN=rsmA PE=3 SV=1 36 248 1.0E-26
sp|B9MIF6|RSMA_ACIET Ribosomal RNA small subunit methyltransferase A OS=Acidovorax ebreus (strain TPSY) GN=rsmA PE=3 SV=1 43 279 2.0E-26
sp|Q7V7W0|RSMA_PROMM Ribosomal RNA small subunit methyltransferase A OS=Prochlorococcus marinus (strain MIT 9313) GN=rsmA PE=3 SV=1 43 249 2.0E-26
sp|Q2KXA2|RSMA_BORA1 Ribosomal RNA small subunit methyltransferase A OS=Bordetella avium (strain 197N) GN=rsmA PE=3 SV=1 43 249 2.0E-26
sp|Q47VJ8|RSMA_COLP3 Ribosomal RNA small subunit methyltransferase A OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rsmA PE=3 SV=1 43 252 2.0E-26
sp|Q4JU23|RSMA_CORJK Ribosomal RNA small subunit methyltransferase A OS=Corynebacterium jeikeium (strain K411) GN=rsmA PE=3 SV=1 42 254 2.0E-26
sp|Q88QT6|RSMA_PSEPK Ribosomal RNA small subunit methyltransferase A OS=Pseudomonas putida (strain KT2440) GN=rsmA PE=3 SV=1 43 261 2.0E-26
sp|A1WD86|RSMA_ACISJ Ribosomal RNA small subunit methyltransferase A OS=Acidovorax sp. (strain JS42) GN=rsmA PE=3 SV=1 43 279 2.0E-26
sp|Q6F8A0|RSMA_ACIAD Ribosomal RNA small subunit methyltransferase A OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rsmA PE=3 SV=1 43 254 2.0E-26
sp|B4F2I2|RSMA_PROMH Ribosomal RNA small subunit methyltransferase A OS=Proteus mirabilis (strain HI4320) GN=rsmA PE=3 SV=1 43 261 2.0E-26
sp|Q60B77|RSMA_METCA Ribosomal RNA small subunit methyltransferase A OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rsmA PE=3 SV=1 43 262 2.0E-26
sp|A2CA51|RSMA_PROM3 Ribosomal RNA small subunit methyltransferase A OS=Prochlorococcus marinus (strain MIT 9303) GN=rsmA PE=3 SV=1 43 249 3.0E-26
sp|B7VIE2|RSMA_VIBTL Ribosomal RNA small subunit methyltransferase A OS=Vibrio tasmaniensis (strain LGP32) GN=rsmA PE=3 SV=1 43 259 3.0E-26
sp|C6DEY6|RSMA_PECCP Ribosomal RNA small subunit methyltransferase A OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rsmA PE=3 SV=1 43 260 3.0E-26
sp|B4S787|RSMA_PROA2 Ribosomal RNA small subunit methyltransferase A OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rsmA PE=3 SV=1 42 249 3.0E-26
sp|Q0I9S3|RSMA_SYNS3 Ribosomal RNA small subunit methyltransferase A OS=Synechococcus sp. (strain CC9311) GN=rsmA PE=3 SV=1 43 259 4.0E-26
sp|C1ESX0|RSMA_BACC3 Ribosomal RNA small subunit methyltransferase A OS=Bacillus cereus (strain 03BB102) GN=rsmA PE=3 SV=1 36 247 4.0E-26
sp|A0R8B4|RSMA_BACAH Ribosomal RNA small subunit methyltransferase A OS=Bacillus thuringiensis (strain Al Hakam) GN=rsmA PE=3 SV=1 36 247 4.0E-26
sp|Q5P7J1|RSMA_AROAE Ribosomal RNA small subunit methyltransferase A OS=Aromatoleum aromaticum (strain EbN1) GN=rsmA PE=3 SV=1 43 253 4.0E-26
sp|Q6HPX5|RSMA_BACHK Ribosomal RNA small subunit methyltransferase A OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rsmA PE=3 SV=1 36 247 4.0E-26
sp|Q63HJ1|RSMA_BACCZ Ribosomal RNA small subunit methyltransferase A OS=Bacillus cereus (strain ZK / E33L) GN=rsmA PE=3 SV=1 36 247 4.0E-26
sp|B9IZC4|RSMA_BACCQ Ribosomal RNA small subunit methyltransferase A OS=Bacillus cereus (strain Q1) GN=rsmA PE=3 SV=1 36 247 4.0E-26
sp|B7HPV2|RSMA_BACC7 Ribosomal RNA small subunit methyltransferase A OS=Bacillus cereus (strain AH187) GN=rsmA PE=3 SV=1 36 247 4.0E-26
sp|Q73FG7|RSMA_BACC1 Ribosomal RNA small subunit methyltransferase A OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rsmA PE=3 SV=1 36 247 4.0E-26
sp|B7JK47|RSMA_BACC0 Ribosomal RNA small subunit methyltransferase A OS=Bacillus cereus (strain AH820) GN=rsmA PE=3 SV=1 36 247 4.0E-26
sp|Q81W00|RSMA_BACAN Ribosomal RNA small subunit methyltransferase A OS=Bacillus anthracis GN=rsmA PE=3 SV=1 36 247 4.0E-26
sp|C3LJ13|RSMA_BACAC Ribosomal RNA small subunit methyltransferase A OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rsmA PE=3 SV=1 36 247 4.0E-26
sp|C3P9I6|RSMA_BACAA Ribosomal RNA small subunit methyltransferase A OS=Bacillus anthracis (strain A0248) GN=rsmA PE=3 SV=1 36 247 4.0E-26
sp|Q38V22|RSMA_LACSS Ribosomal RNA small subunit methyltransferase A OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rsmA PE=3 SV=1 36 248 5.0E-26
sp|B2J0A6|RSMA_NOSP7 Ribosomal RNA small subunit methyltransferase A OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rsmA PE=3 SV=1 43 249 5.0E-26
sp|Q3A8X5|RSMA_CARHZ Ribosomal RNA small subunit methyltransferase A OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rsmA PE=3 SV=1 38 266 5.0E-26
sp|Q8CQU5|RSMA_STAES Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rsmA PE=3 SV=1 36 252 6.0E-26
sp|Q5HRR2|RSMA_STAEQ Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rsmA PE=3 SV=1 36 252 6.0E-26
sp|A0KGT8|RSMA_AERHH Ribosomal RNA small subunit methyltransferase A OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rsmA PE=3 SV=1 43 252 6.0E-26
sp|Q81JA5|RSMA_BACCR Ribosomal RNA small subunit methyltransferase A OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rsmA PE=3 SV=1 36 247 6.0E-26
sp|B7HIK9|RSMA_BACC4 Ribosomal RNA small subunit methyltransferase A OS=Bacillus cereus (strain B4264) GN=rsmA PE=3 SV=1 36 247 6.0E-26
sp|B7ISV1|RSMA_BACC2 Ribosomal RNA small subunit methyltransferase A OS=Bacillus cereus (strain G9842) GN=rsmA PE=3 SV=1 36 247 6.0E-26
sp|Q6D0E0|RSMA_PECAS Ribosomal RNA small subunit methyltransferase A OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rsmA PE=3 SV=1 43 259 7.0E-26
sp|Q3JAF3|RSMA_NITOC Ribosomal RNA small subunit methyltransferase A OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rsmA PE=3 SV=1 43 261 7.0E-26
sp|Q7MP86|RSMA_VIBVY Ribosomal RNA small subunit methyltransferase A OS=Vibrio vulnificus (strain YJ016) GN=rsmA PE=3 SV=1 43 259 8.0E-26
sp|Q8DED2|RSMA_VIBVU Ribosomal RNA small subunit methyltransferase A OS=Vibrio vulnificus (strain CMCP6) GN=rsmA PE=3 SV=1 43 259 8.0E-26
sp|Q21MT0|RSMA_SACD2 Ribosomal RNA small subunit methyltransferase A OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rsmA PE=3 SV=1 43 249 1.0E-25
sp|A4IJB8|RSMA_GEOTN Ribosomal RNA small subunit methyltransferase A OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rsmA PE=3 SV=1 36 247 1.0E-25
sp|A7GJV3|RSMA_BACCN Ribosomal RNA small subunit methyltransferase A OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rsmA PE=3 SV=1 36 247 1.0E-25
sp|A9KGZ8|RSMA_COXBN Ribosomal RNA small subunit methyltransferase A OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rsmA PE=3 SV=1 43 248 1.0E-25
sp|A9VN54|RSMA_BACWK Ribosomal RNA small subunit methyltransferase A OS=Bacillus weihenstephanensis (strain KBAB4) GN=rsmA PE=3 SV=1 36 247 1.0E-25
sp|Q83AC2|RSMA_COXBU Ribosomal RNA small subunit methyltransferase A OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rsmA PE=1 SV=2 43 248 1.0E-25
sp|B6J3A6|RSMA_COXB2 Ribosomal RNA small subunit methyltransferase A OS=Coxiella burnetii (strain CbuG_Q212) GN=rsmA PE=3 SV=1 43 248 1.0E-25
sp|B3EIC2|RSMA_CHLL2 Ribosomal RNA small subunit methyltransferase A OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rsmA PE=3 SV=1 41 248 1.0E-25
sp|A0L064|RSMA_SHESA Ribosomal RNA small subunit methyltransferase A OS=Shewanella sp. (strain ANA-3) GN=rsmA PE=3 SV=1 43 260 1.0E-25
sp|B3EQT0|RSMA_CHLPB Ribosomal RNA small subunit methyltransferase A OS=Chlorobium phaeobacteroides (strain BS1) GN=rsmA PE=3 SV=1 42 249 1.0E-25
sp|Q0S4T6|RSMA_RHOJR Ribosomal RNA small subunit methyltransferase A OS=Rhodococcus jostii (strain RHA1) GN=rsmA PE=3 SV=1 41 255 1.0E-25
sp|A1RRK0|RSMA_PYRIL Probable ribosomal RNA small subunit methyltransferase A OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rsmA PE=3 SV=1 43 257 1.0E-25
sp|A5GTK9|RSMA_SYNR3 Ribosomal RNA small subunit methyltransferase A OS=Synechococcus sp. (strain RCC307) GN=rsmA PE=3 SV=1 43 249 1.0E-25
sp|B5FGG5|RSMA_VIBFM Ribosomal RNA small subunit methyltransferase A OS=Vibrio fischeri (strain MJ11) GN=rsmA PE=3 SV=1 43 259 1.0E-25
sp|Q5E865|RSMA_VIBF1 Ribosomal RNA small subunit methyltransferase A OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rsmA PE=3 SV=1 43 259 1.0E-25
sp|Q0HS06|RSMA_SHESR Ribosomal RNA small subunit methyltransferase A OS=Shewanella sp. (strain MR-7) GN=rsmA PE=3 SV=1 43 260 1.0E-25
sp|Q0HLT2|RSMA_SHESM Ribosomal RNA small subunit methyltransferase A OS=Shewanella sp. (strain MR-4) GN=rsmA PE=3 SV=1 43 260 1.0E-25
sp|Q4L3F0|RSMA_STAHJ Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rsmA PE=3 SV=1 20 252 2.0E-25
sp|Q3AKE0|RSMA_SYNSC Ribosomal RNA small subunit methyltransferase A OS=Synechococcus sp. (strain CC9605) GN=rsmA PE=3 SV=1 43 257 2.0E-25
sp|B6J641|RSMA_COXB1 Ribosomal RNA small subunit methyltransferase A OS=Coxiella burnetii (strain CbuK_Q154) GN=rsmA PE=3 SV=1 43 248 2.0E-25
sp|A3QBA3|RSMA_SHELP Ribosomal RNA small subunit methyltransferase A OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rsmA PE=3 SV=1 43 249 2.0E-25
sp|Q9RED9|RSMA_BURSP Ribosomal RNA small subunit methyltransferase A OS=Burkholderia sp. GN=rsmA PE=3 SV=1 43 249 2.0E-25
sp|B6EL48|RSMA_ALISL Ribosomal RNA small subunit methyltransferase A OS=Aliivibrio salmonicida (strain LFI1238) GN=rsmA PE=3 SV=1 43 259 2.0E-25
sp|Q5YPY6|RSMA_NOCFA Ribosomal RNA small subunit methyltransferase A OS=Nocardia farcinica (strain IFM 10152) GN=rsmA PE=3 SV=1 41 255 2.0E-25
sp|Q07YJ8|RSMA_SHEFN Ribosomal RNA small subunit methyltransferase A OS=Shewanella frigidimarina (strain NCIMB 400) GN=rsmA PE=3 SV=1 43 249 3.0E-25
sp|A0LA32|RSMA_MAGMM Ribosomal RNA small subunit methyltransferase A OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rsmA PE=3 SV=1 39 249 3.0E-25
sp|Q8EB93|RSMA_SHEON Ribosomal RNA small subunit methyltransferase A OS=Shewanella oneidensis (strain MR-1) GN=rsmA PE=3 SV=1 43 260 3.0E-25
sp|C1F127|RSMA_ACIC5 Ribosomal RNA small subunit methyltransferase A OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=rsmA PE=3 SV=1 37 248 3.0E-25
sp|C5D363|RSMA_GEOSW Ribosomal RNA small subunit methyltransferase A OS=Geobacillus sp. (strain WCH70) GN=rsmA PE=3 SV=1 36 248 4.0E-25
sp|P37468|RSMA_BACSU Ribosomal RNA small subunit methyltransferase A OS=Bacillus subtilis (strain 168) GN=rsmA PE=3 SV=1 36 247 4.0E-25
sp|B9DLD0|RSMA_STACT Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus carnosus (strain TM300) GN=rsmA PE=3 SV=1 36 252 4.0E-25
sp|B1WRJ7|RSMA_CYAA5 Ribosomal RNA small subunit methyltransferase A OS=Cyanothece sp. (strain ATCC 51142) GN=rsmA PE=3 SV=1 43 249 5.0E-25
sp|A7MWC6|RSMA_VIBCB Ribosomal RNA small subunit methyltransferase A OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rsmA PE=3 SV=1 43 259 5.0E-25
sp|A9N9I7|RSMA_COXBR Ribosomal RNA small subunit methyltransferase A OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rsmA PE=3 SV=1 43 248 5.0E-25
sp|C1AXY5|RSMA_RHOOB Ribosomal RNA small subunit methyltransferase A OS=Rhodococcus opacus (strain B4) GN=rsmA PE=3 SV=1 41 255 5.0E-25
sp|B0TV52|RSMA_SHEHH Ribosomal RNA small subunit methyltransferase A OS=Shewanella halifaxensis (strain HAW-EB4) GN=rsmA PE=3 SV=1 43 249 7.0E-25
sp|A5EY68|RSMA_DICNV Ribosomal RNA small subunit methyltransferase A OS=Dichelobacter nodosus (strain VCS1703A) GN=rsmA PE=3 SV=1 42 261 7.0E-25
sp|B0CC89|RSMA_ACAM1 Ribosomal RNA small subunit methyltransferase A OS=Acaryochloris marina (strain MBIC 11017) GN=rsmA PE=3 SV=1 43 249 7.0E-25
sp|Q87ST6|RSMA_VIBPA Ribosomal RNA small subunit methyltransferase A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rsmA PE=3 SV=1 43 259 8.0E-25
sp|Q65PH9|RSMA_BACLD Ribosomal RNA small subunit methyltransferase A OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rsmA PE=3 SV=1 36 248 8.0E-25
sp|Q8YS62|RSMA_NOSS1 Ribosomal RNA small subunit methyltransferase A OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rsmA PE=3 SV=1 43 249 9.0E-25
sp|Q2S9C3|RSMA_HAHCH Ribosomal RNA small subunit methyltransferase A OS=Hahella chejuensis (strain KCTC 2396) GN=rsmA PE=3 SV=1 43 249 9.0E-25
sp|Q6LV41|RSMA_PHOPR Ribosomal RNA small subunit methyltransferase A OS=Photobacterium profundum GN=rsmA PE=3 SV=2 43 252 1.0E-24
sp|A3D188|RSMA_SHEB5 Ribosomal RNA small subunit methyltransferase A OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rsmA PE=3 SV=1 43 249 1.0E-24
sp|B8EB35|RSMA_SHEB2 Ribosomal RNA small subunit methyltransferase A OS=Shewanella baltica (strain OS223) GN=rsmA PE=3 SV=1 43 249 1.0E-24
sp|A9L438|RSMA_SHEB9 Ribosomal RNA small subunit methyltransferase A OS=Shewanella baltica (strain OS195) GN=rsmA PE=3 SV=1 43 249 1.0E-24
sp|A6WK59|RSMA_SHEB8 Ribosomal RNA small subunit methyltransferase A OS=Shewanella baltica (strain OS185) GN=rsmA PE=3 SV=1 43 249 1.0E-24
sp|Q9PBJ6|RSMA_XYLFA Ribosomal RNA small subunit methyltransferase A OS=Xylella fastidiosa (strain 9a5c) GN=rsmA PE=3 SV=2 43 252 2.0E-24
sp|A7FQA9|RSMA_CLOB1 Ribosomal RNA small subunit methyltransferase A OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rsmA PE=3 SV=1 36 248 2.0E-24
sp|Q3M3F3|RSMA_ANAVT Ribosomal RNA small subunit methyltransferase A OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rsmA PE=3 SV=1 43 249 2.0E-24
sp|B2VGP6|RSMA_ERWT9 Ribosomal RNA small subunit methyltransferase A OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rsmA PE=3 SV=1 43 260 2.0E-24
sp|Q97EX0|RSMA_CLOAB Ribosomal RNA small subunit methyltransferase A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rsmA PE=3 SV=1 36 256 2.0E-24
sp|Q1LRA1|RSMA_CUPMC Ribosomal RNA small subunit methyltransferase A OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rsmA PE=3 SV=1 43 219 2.0E-24
sp|A7G9I5|RSMA_CLOBL Ribosomal RNA small subunit methyltransferase A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rsmA PE=3 SV=1 36 248 3.0E-24
sp|A5GLH7|RSMA_SYNPW Ribosomal RNA small subunit methyltransferase A OS=Synechococcus sp. (strain WH7803) GN=rsmA PE=3 SV=1 43 249 3.0E-24
sp|C1FQ40|RSMA_CLOBJ Ribosomal RNA small subunit methyltransferase A OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rsmA PE=3 SV=1 36 248 3.0E-24
sp|Q87C85|RSMA_XYLFT Ribosomal RNA small subunit methyltransferase A OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rsmA PE=3 SV=1 38 252 3.0E-24
sp|A8F909|RSMA_BACP2 Ribosomal RNA small subunit methyltransferase A OS=Bacillus pumilus (strain SAFR-032) GN=rsmA PE=3 SV=1 36 268 3.0E-24
sp|B1ID54|RSMA_CLOBK Ribosomal RNA small subunit methyltransferase A OS=Clostridium botulinum (strain Okra / Type B1) GN=rsmA PE=3 SV=1 36 248 3.0E-24
sp|B1KGH9|RSMA_SHEWM Ribosomal RNA small subunit methyltransferase A OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rsmA PE=3 SV=1 43 249 3.0E-24
sp|Q5ZZN4|RSMA_MYCH2 Ribosomal RNA small subunit methyltransferase A OS=Mycoplasma hyopneumoniae (strain 232) GN=rsmA PE=3 SV=1 42 248 3.0E-24
sp|Q9X1F1|RSMA_THEMA Ribosomal RNA small subunit methyltransferase A OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rsmA PE=3 SV=1 37 249 3.0E-24
sp|A1WS95|RSMA_VEREI Ribosomal RNA small subunit methyltransferase A OS=Verminephrobacter eiseniae (strain EF01-2) GN=rsmA PE=3 SV=1 29 281 3.0E-24
sp|B1N079|RSMA_LEUCK Ribosomal RNA small subunit methyltransferase A OS=Leuconostoc citreum (strain KM20) GN=rsmA PE=3 SV=1 43 248 3.0E-24
sp|A6UP00|RSMA_METVS Probable ribosomal RNA small subunit methyltransferase A OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rsmA PE=3 SV=1 42 255 4.0E-24
sp|Q7N8V7|RSMA_PHOLL Ribosomal RNA small subunit methyltransferase A OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rsmA PE=3 SV=1 43 252 4.0E-24
sp|Q1QAR8|RSMA_PSYCK Ribosomal RNA small subunit methyltransferase A OS=Psychrobacter cryohalolentis (strain K5) GN=rsmA PE=3 SV=1 43 273 4.0E-24
sp|Q1LSS2|RSMA_BAUCH Ribosomal RNA small subunit methyltransferase A OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rsmA PE=3 SV=1 42 252 4.0E-24
sp|Q5FMG3|RSMA_LACAC Ribosomal RNA small subunit methyltransferase A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rsmA PE=3 SV=1 20 248 4.0E-24
sp|B1XIV9|RSMA_SYNP2 Ribosomal RNA small subunit methyltransferase A OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rsmA PE=3 SV=1 43 249 5.0E-24
sp|A8YX55|RSMA_LACH4 Ribosomal RNA small subunit methyltransferase A OS=Lactobacillus helveticus (strain DPC 4571) GN=rsmA PE=3 SV=1 20 248 5.0E-24
sp|C4L9L4|RSMA_TOLAT Ribosomal RNA small subunit methyltransferase A OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rsmA PE=3 SV=1 43 252 5.0E-24
sp|Q3SGF7|RSMA_THIDA Ribosomal RNA small subunit methyltransferase A OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rsmA PE=3 SV=1 43 249 6.0E-24
sp|A8FRV2|RSMA_SHESH Ribosomal RNA small subunit methyltransferase A OS=Shewanella sediminis (strain HAW-EB3) GN=rsmA PE=3 SV=1 43 249 6.0E-24
sp|B9E8V8|RSMA_MACCJ Ribosomal RNA small subunit methyltransferase A OS=Macrococcus caseolyticus (strain JCSC5402) GN=rsmA PE=3 SV=1 36 254 7.0E-24
sp|B1LBH5|RSMA_THESQ Ribosomal RNA small subunit methyltransferase A OS=Thermotoga sp. (strain RQ2) GN=rsmA PE=3 SV=1 37 249 8.0E-24
sp|P59157|RSMA_THEEB Ribosomal RNA small subunit methyltransferase A OS=Thermosynechococcus elongatus (strain BP-1) GN=rsmA PE=3 SV=1 35 248 8.0E-24
sp|Q7P1U1|RSMA_CHRVO Ribosomal RNA small subunit methyltransferase A OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rsmA PE=3 SV=1 43 254 8.0E-24
sp|Q223E6|RSMA_RHOFT Ribosomal RNA small subunit methyltransferase A OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rsmA PE=3 SV=1 43 256 8.0E-24
sp|Q7VU11|RSMA_BORPE Ribosomal RNA small subunit methyltransferase A OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rsmA PE=3 SV=1 43 249 9.0E-24
sp|Q7WG20|RSMA_BORBR Ribosomal RNA small subunit methyltransferase A OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rsmA PE=3 SV=1 43 249 9.0E-24
sp|A8H0V2|RSMA_SHEPA Ribosomal RNA small subunit methyltransferase A OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rsmA PE=3 SV=1 43 249 1.0E-23
sp|Q2S0I2|RSMA_SALRD Ribosomal RNA small subunit methyltransferase A OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rsmA PE=3 SV=1 36 258 1.0E-23
sp|A1STS1|RSMA_PSYIN Ribosomal RNA small subunit methyltransferase A OS=Psychromonas ingrahamii (strain 37) GN=rsmA PE=3 SV=1 43 261 1.0E-23
sp|C3KXY4|RSMA_CLOB6 Ribosomal RNA small subunit methyltransferase A OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rsmA PE=3 SV=1 36 248 1.0E-23
sp|Q7W4J6|RSMA_BORPA Ribosomal RNA small subunit methyltransferase A OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rsmA PE=3 SV=1 43 249 1.0E-23
sp|Q47SX4|RSMA_THEFY Ribosomal RNA small subunit methyltransferase A OS=Thermobifida fusca (strain YX) GN=rsmA PE=3 SV=1 41 249 1.0E-23
sp|C0QFJ2|RSMA_DESAH Ribosomal RNA small subunit methyltransferase A OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rsmA PE=3 SV=1 42 254 1.0E-23
sp|A5IME8|RSMA_THEP1 Ribosomal RNA small subunit methyltransferase A OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rsmA PE=3 SV=1 37 249 1.0E-23
sp|Q4A936|RSMA_MYCHJ Ribosomal RNA small subunit methyltransferase A OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rsmA PE=3 SV=2 41 248 1.0E-23
sp|Q74LI0|RSMA_LACJO Ribosomal RNA small subunit methyltransferase A OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rsmA PE=3 SV=1 41 248 1.0E-23
sp|B1JKY3|RSMA_YERPY Ribosomal RNA small subunit methyltransferase A OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rsmA PE=3 SV=1 43 259 2.0E-23
sp|Q66EQ8|RSMA_YERPS Ribosomal RNA small subunit methyltransferase A OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rsmA PE=3 SV=1 43 259 2.0E-23
sp|A4TQD8|RSMA_YERPP Ribosomal RNA small subunit methyltransferase A OS=Yersinia pestis (strain Pestoides F) GN=rsmA PE=3 SV=1 43 259 2.0E-23
sp|Q1CMT2|RSMA_YERPN Ribosomal RNA small subunit methyltransferase A OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rsmA PE=3 SV=1 43 259 2.0E-23
sp|A9QZZ0|RSMA_YERPG Ribosomal RNA small subunit methyltransferase A OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rsmA PE=3 SV=1 43 259 2.0E-23
sp|Q8ZIK5|RSMA_YERPE Ribosomal RNA small subunit methyltransferase A OS=Yersinia pestis GN=rsmA PE=3 SV=1 43 259 2.0E-23
sp|B2K487|RSMA_YERPB Ribosomal RNA small subunit methyltransferase A OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rsmA PE=3 SV=1 43 259 2.0E-23
sp|Q1C0H5|RSMA_YERPA Ribosomal RNA small subunit methyltransferase A OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rsmA PE=3 SV=1 43 259 2.0E-23
sp|A7FMC1|RSMA_YERP3 Ribosomal RNA small subunit methyltransferase A OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rsmA PE=3 SV=1 43 259 2.0E-23
sp|Q8G6I3|RSMA_BIFLO Ribosomal RNA small subunit methyltransferase A OS=Bifidobacterium longum (strain NCC 2705) GN=rsmA PE=3 SV=1 43 251 2.0E-23
sp|B0RUI3|RSMA_XANCB Ribosomal RNA small subunit methyltransferase A OS=Xanthomonas campestris pv. campestris (strain B100) GN=rsmA PE=3 SV=1 41 249 2.0E-23
sp|B1KRY8|RSMA_CLOBM Ribosomal RNA small subunit methyltransferase A OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rsmA PE=3 SV=1 36 248 2.0E-23
sp|Q9K3R5|RSMA_STRCO Ribosomal RNA small subunit methyltransferase A OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rsmA PE=3 SV=1 43 249 2.0E-23
sp|Q12K59|RSMA_SHEDO Ribosomal RNA small subunit methyltransferase A OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rsmA PE=3 SV=1 43 249 2.0E-23
sp|Q0KEA7|RSMA_CUPNH Ribosomal RNA small subunit methyltransferase A OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rsmA PE=3 SV=1 43 219 2.0E-23
sp|Q8PCE3|RSMA_XANCP Ribosomal RNA small subunit methyltransferase A OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rsmA PE=3 SV=1 41 249 2.0E-23
sp|Q4UR39|RSMA_XANC8 Ribosomal RNA small subunit methyltransferase A OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rsmA PE=3 SV=1 41 249 2.0E-23
sp|P44749|RSMA_HAEIN Ribosomal RNA small subunit methyltransferase A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rsmA PE=3 SV=1 43 249 2.0E-23
sp|A5UH57|RSMA_HAEIG Ribosomal RNA small subunit methyltransferase A OS=Haemophilus influenzae (strain PittGG) GN=rsmA PE=3 SV=1 43 249 3.0E-23
sp|A5U9U3|RSMA_HAEIE Ribosomal RNA small subunit methyltransferase A OS=Haemophilus influenzae (strain PittEE) GN=rsmA PE=3 SV=1 43 249 3.0E-23
sp|A9B9Y0|RSMA_PROM4 Ribosomal RNA small subunit methyltransferase A OS=Prochlorococcus marinus (strain MIT 9211) GN=rsmA PE=3 SV=1 43 249 3.0E-23
sp|B8D0I2|RSMA_HALOH Ribosomal RNA small subunit methyltransferase A OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rsmA PE=3 SV=1 24 258 3.0E-23
sp|Q49V02|RSMA_STAS1 Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rsmA PE=3 SV=1 20 252 3.0E-23
sp|A1RMU8|RSMA_SHESW Ribosomal RNA small subunit methyltransferase A OS=Shewanella sp. (strain W3-18-1) GN=rsmA PE=3 SV=1 43 249 4.0E-23
sp|A4Y435|RSMA_SHEPC Ribosomal RNA small subunit methyltransferase A OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rsmA PE=3 SV=1 43 249 4.0E-23
sp|A8G9P0|RSMA_SERP5 Ribosomal RNA small subunit methyltransferase A OS=Serratia proteamaculans (strain 568) GN=rsmA PE=3 SV=1 43 252 4.0E-23
sp|B9K8F0|RSMA_THENN Ribosomal RNA small subunit methyltransferase A OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rsmA PE=3 SV=1 37 249 4.0E-23
sp|Q82HC3|RSMA_STRAW Ribosomal RNA small subunit methyltransferase A OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rsmA PE=3 SV=1 43 249 4.0E-23
sp|P59524|RSMA_BUCBP Ribosomal RNA small subunit methyltransferase A OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rsmA PE=3 SV=1 32 220 6.0E-23
sp|Q4FT44|RSMA_PSYA2 Ribosomal RNA small subunit methyltransferase A OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rsmA PE=3 SV=1 43 273 6.0E-23
sp|B2AH89|RSMA_CUPTR Ribosomal RNA small subunit methyltransferase A OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rsmA PE=3 SV=1 43 219 6.0E-23
sp|Q63X76|RSMA_BURPS Ribosomal RNA small subunit methyltransferase A OS=Burkholderia pseudomallei (strain K96243) GN=rsmA PE=1 SV=1 43 259 6.0E-23
sp|Q3JVW6|RSMA_BURP1 Ribosomal RNA small subunit methyltransferase A OS=Burkholderia pseudomallei (strain 1710b) GN=rsmA PE=3 SV=1 43 259 6.0E-23
sp|A1V727|RSMA_BURMS Ribosomal RNA small subunit methyltransferase A OS=Burkholderia mallei (strain SAVP1) GN=rsmA PE=3 SV=1 43 259 6.0E-23
sp|Q62MM2|RSMA_BURMA Ribosomal RNA small subunit methyltransferase A OS=Burkholderia mallei (strain ATCC 23344) GN=rsmA PE=3 SV=1 43 259 6.0E-23
sp|A2S8N7|RSMA_BURM9 Ribosomal RNA small subunit methyltransferase A OS=Burkholderia mallei (strain NCTC 10229) GN=rsmA PE=3 SV=1 43 259 6.0E-23
sp|A3MNW4|RSMA_BURM7 Ribosomal RNA small subunit methyltransferase A OS=Burkholderia mallei (strain NCTC 10247) GN=rsmA PE=3 SV=1 43 259 6.0E-23
sp|Q0SQ34|RSMA_CLOPS Ribosomal RNA small subunit methyltransferase A OS=Clostridium perfringens (strain SM101 / Type A) GN=rsmA PE=3 SV=1 36 258 6.0E-23
sp|Q8XHG8|RSMA_CLOPE Ribosomal RNA small subunit methyltransferase A OS=Clostridium perfringens (strain 13 / Type A) GN=rsmA PE=3 SV=1 36 258 6.0E-23
sp|Q0TMD6|RSMA_CLOP1 Ribosomal RNA small subunit methyltransferase A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rsmA PE=3 SV=1 36 258 6.0E-23
sp|A3N5X6|RSMA_BURP6 Ribosomal RNA small subunit methyltransferase A OS=Burkholderia pseudomallei (strain 668) GN=rsmA PE=3 SV=1 43 259 7.0E-23
sp|A3NRM0|RSMA_BURP0 Ribosomal RNA small subunit methyltransferase A OS=Burkholderia pseudomallei (strain 1106a) GN=rsmA PE=3 SV=1 43 259 7.0E-23
sp|Q04DR8|RSMA_OENOB Ribosomal RNA small subunit methyltransferase A OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rsmA PE=3 SV=1 42 253 7.0E-23
sp|Q2JMR8|RSMA_SYNJB Ribosomal RNA small subunit methyltransferase A OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rsmA PE=3 SV=1 43 220 8.0E-23
sp|Q493R7|RSMA_BLOPB Ribosomal RNA small subunit methyltransferase A OS=Blochmannia pennsylvanicus (strain BPEN) GN=rsmA PE=3 SV=1 43 251 9.0E-23
sp|A0LR93|RSMA_ACIC1 Ribosomal RNA small subunit methyltransferase A OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rsmA PE=3 SV=1 43 257 9.0E-23
sp|Q5WLW2|RSMA_BACSK Ribosomal RNA small subunit methyltransferase A OS=Bacillus clausii (strain KSM-K16) GN=rsmA PE=3 SV=1 32 248 1.0E-22
sp|Q475Q1|RSMA_CUPPJ Ribosomal RNA small subunit methyltransferase A OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rsmA PE=3 SV=1 43 249 1.0E-22
sp|Q3B3D4|RSMA_CHLL7 Ribosomal RNA small subunit methyltransferase A OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rsmA PE=3 SV=1 32 248 1.0E-22
sp|Q9I5U5|RSMA_PSEAE Ribosomal RNA small subunit methyltransferase A OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rsmA PE=3 SV=1 43 249 1.0E-22
sp|Q1GZB8|RSMA_METFK Ribosomal RNA small subunit methyltransferase A OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rsmA PE=3 SV=1 43 254 1.0E-22
sp|Q4A645|RSMA_MYCS5 Ribosomal RNA small subunit methyltransferase A OS=Mycoplasma synoviae (strain 53) GN=rsmA PE=3 SV=1 42 265 1.0E-22
sp|Q2RME8|RSMA_MOOTA Ribosomal RNA small subunit methyltransferase A OS=Moorella thermoacetica (strain ATCC 39073) GN=rsmA PE=3 SV=1 43 248 1.0E-22
sp|Q251W8|RSMA_DESHY Ribosomal RNA small subunit methyltransferase A OS=Desulfitobacterium hafniense (strain Y51) GN=rsmA PE=3 SV=1 37 254 1.0E-22
sp|B8FY38|RSMA_DESHD Ribosomal RNA small subunit methyltransferase A OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rsmA PE=3 SV=1 37 254 1.0E-22
sp|B0TZ54|RSMA_FRAP2 Ribosomal RNA small subunit methyltransferase A OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rsmA PE=3 SV=1 41 255 1.0E-22
sp|Q3AXF3|RSMA_SYNS9 Ribosomal RNA small subunit methyltransferase A OS=Synechococcus sp. (strain CC9902) GN=rsmA PE=3 SV=1 43 255 1.0E-22
sp|Q4A775|RSMA_MYCH7 Ribosomal RNA small subunit methyltransferase A OS=Mycoplasma hyopneumoniae (strain 7448) GN=rsmA PE=3 SV=2 41 248 1.0E-22
sp|Q4QMZ9|RSMA_HAEI8 Ribosomal RNA small subunit methyltransferase A OS=Haemophilus influenzae (strain 86-028NP) GN=rsmA PE=3 SV=1 43 249 1.0E-22
sp|P0DF13|RSMA_STRPQ Ribosomal RNA small subunit methyltransferase A OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rsmA PE=3 SV=1 36 248 2.0E-22
sp|P0DF12|RSMA_STRP3 Ribosomal RNA small subunit methyltransferase A OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rsmA PE=3 SV=1 36 248 2.0E-22
sp|B8CSX5|RSMA_SHEPW Ribosomal RNA small subunit methyltransferase A OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rsmA PE=3 SV=1 43 249 2.0E-22
sp|Q1QZ31|RSMA_CHRSD Ribosomal RNA small subunit methyltransferase A OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rsmA PE=3 SV=1 43 249 2.0E-22
sp|C0M8P2|RSMA_STRE4 Ribosomal RNA small subunit methyltransferase A OS=Streptococcus equi subsp. equi (strain 4047) GN=rsmA PE=3 SV=1 36 248 2.0E-22
sp|Q9PK40|RSMA_CHLMU Ribosomal RNA small subunit methyltransferase A OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rsmA PE=3 SV=1 42 251 2.0E-22
sp|C0MF36|RSMA_STRS7 Ribosomal RNA small subunit methyltransferase A OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rsmA PE=3 SV=1 36 248 2.0E-22
sp|B4U0U9|RSMA_STREM Ribosomal RNA small subunit methyltransferase A OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=rsmA PE=3 SV=1 36 248 2.0E-22
sp|A1TWF5|RSMA_ACIAC Ribosomal RNA small subunit methyltransferase A OS=Acidovorax citrulli (strain AAC00-1) GN=rsmA PE=3 SV=1 43 257 2.0E-22
sp|P72666|RSMA_SYNY3 Ribosomal RNA small subunit methyltransferase A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rsmA PE=3 SV=1 36 249 2.0E-22
sp|C4K4K9|RSMA_HAMD5 Ribosomal RNA small subunit methyltransferase A OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rsmA PE=3 SV=1 43 260 2.0E-22
sp|A1JJF4|RSMA_YERE8 Ribosomal RNA small subunit methyltransferase A OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rsmA PE=3 SV=1 43 252 2.0E-22
sp|A9I5F2|RSMA_BORPD Ribosomal RNA small subunit methyltransferase A OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rsmA PE=3 SV=1 43 249 2.0E-22
sp|B7GPE3|RSMA_BIFLS Ribosomal RNA small subunit methyltransferase A OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rsmA PE=3 SV=1 43 251 3.0E-22
sp|Q0AQC3|RSMA_MARMM Ribosomal RNA small subunit methyltransferase A OS=Maricaulis maris (strain MCS10) GN=rsmA PE=3 SV=1 41 219 3.0E-22
sp|A9A0E0|RSMA_DESOH Ribosomal RNA small subunit methyltransferase A OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rsmA PE=3 SV=1 41 217 3.0E-22
sp|Q8KE87|RSMA_CHLTE Ribosomal RNA small subunit methyltransferase A OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rsmA PE=3 SV=1 42 248 3.0E-22
sp|Q2T114|RSMA_BURTA Ribosomal RNA small subunit methyltransferase A OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rsmA PE=3 SV=1 43 259 3.0E-22
sp|B4EBE8|RSMA_BURCJ Ribosomal RNA small subunit methyltransferase A OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rsmA PE=3 SV=1 43 259 4.0E-22
sp|P45438|ERMK_BACLI rRNA adenine N-6-methyltransferase OS=Bacillus licheniformis GN=ermK PE=3 SV=1 43 226 4.0E-22
sp|A1A3W3|RSMA_BIFAA Ribosomal RNA small subunit methyltransferase A OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rsmA PE=3 SV=1 43 251 4.0E-22
sp|Q181C1|RSMA_PEPD6 Ribosomal RNA small subunit methyltransferase A OS=Peptoclostridium difficile (strain 630) GN=rsmA PE=3 SV=1 18 254 4.0E-22
sp|Q39D37|RSMA_BURL3 Ribosomal RNA small subunit methyltransferase A OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rsmA PE=3 SV=1 43 259 4.0E-22
sp|Q7VM33|RSMA_HAEDU Ribosomal RNA small subunit methyltransferase A OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rsmA PE=3 SV=1 43 265 4.0E-22
sp|Q1J8J4|RSMA_STRPF Ribosomal RNA small subunit methyltransferase A OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rsmA PE=3 SV=1 36 248 4.0E-22
sp|Q1IZ94|RSMA_DEIGD Ribosomal RNA small subunit methyltransferase A OS=Deinococcus geothermalis (strain DSM 11300) GN=rsmA PE=3 SV=1 41 249 4.0E-22
sp|Q5HBC6|RSMA_EHRRW Ribosomal RNA small subunit methyltransferase A OS=Ehrlichia ruminantium (strain Welgevonden) GN=rsmA PE=3 SV=1 42 251 5.0E-22
sp|C1D9C2|RSMA_LARHH Ribosomal RNA small subunit methyltransferase A OS=Laribacter hongkongensis (strain HLHK9) GN=rsmA PE=3 SV=1 43 261 5.0E-22
sp|A0KAD1|RSMA_BURCH Ribosomal RNA small subunit methyltransferase A OS=Burkholderia cenocepacia (strain HI2424) GN=rsmA PE=3 SV=1 43 259 5.0E-22
sp|B1JY71|RSMA_BURCC Ribosomal RNA small subunit methyltransferase A OS=Burkholderia cenocepacia (strain MC0-3) GN=rsmA PE=3 SV=1 43 259 5.0E-22
sp|Q1BTQ8|RSMA_BURCA Ribosomal RNA small subunit methyltransferase A OS=Burkholderia cenocepacia (strain AU 1054) GN=rsmA PE=3 SV=1 43 259 5.0E-22
sp|Q8E3D7|RSMA_STRA3 Ribosomal RNA small subunit methyltransferase A OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rsmA PE=3 SV=1 36 248 6.0E-22
sp|B4TWT6|RSMA_SALSV Ribosomal RNA small subunit methyltransferase A OS=Salmonella schwarzengrund (strain CVM19633) GN=rsmA PE=3 SV=1 43 252 6.0E-22
sp|Q5PAV9|RSMA_ANAMM Ribosomal RNA small subunit methyltransferase A OS=Anaplasma marginale (strain St. Maries) GN=rsmA PE=3 SV=1 41 249 7.0E-22
sp|B9KIG4|RSMA_ANAMF Ribosomal RNA small subunit methyltransferase A OS=Anaplasma marginale (strain Florida) GN=rsmA PE=3 SV=1 41 249 7.0E-22
sp|Q7MXN7|RSMA_PORGI Ribosomal RNA small subunit methyltransferase A OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rsmA PE=3 SV=1 42 255 7.0E-22
sp|B2RHC2|RSMA_PORG3 Ribosomal RNA small subunit methyltransferase A OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rsmA PE=3 SV=1 42 255 7.0E-22
sp|A1TEH3|RSMA_MYCVP Ribosomal RNA small subunit methyltransferase A OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rsmA PE=3 SV=1 36 255 7.0E-22
sp|B7N7S6|RSMA_ECOLU Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rsmA PE=3 SV=1 43 285 8.0E-22
sp|A0Q5E0|RSMA_FRATN Ribosomal RNA small subunit methyltransferase A OS=Francisella tularensis subsp. novicida (strain U112) GN=rsmA PE=3 SV=1 41 249 8.0E-22
sp|A2RCH2|RSMA_STRPG Ribosomal RNA small subunit methyltransferase A OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rsmA PE=3 SV=1 36 248 8.0E-22
sp|Q5XDX4|RSMA_STRP6 Ribosomal RNA small subunit methyltransferase A OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rsmA PE=3 SV=2 36 248 8.0E-22
sp|Q9A1I0|RSMA_STRP1 Ribosomal RNA small subunit methyltransferase A OS=Streptococcus pyogenes serotype M1 GN=rsmA PE=3 SV=1 36 248 8.0E-22
sp|A6LF39|RSMA_PARD8 Ribosomal RNA small subunit methyltransferase A OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rsmA PE=3 SV=1 42 251 8.0E-22
sp|Q8P2N8|RSMA_STRP8 Ribosomal RNA small subunit methyltransferase A OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rsmA PE=3 SV=1 36 248 8.0E-22
sp|A4T6P3|RSMA_MYCGI Ribosomal RNA small subunit methyltransferase A OS=Mycobacterium gilvum (strain PYR-GCK) GN=rsmA PE=3 SV=1 36 255 9.0E-22
sp|Q3IFD1|RSMA_PSEHT Ribosomal RNA small subunit methyltransferase A OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rsmA PE=3 SV=1 43 252 9.0E-22
sp|Q5FH30|RSMA_EHRRG Ribosomal RNA small subunit methyltransferase A OS=Ehrlichia ruminantium (strain Gardel) GN=rsmA PE=3 SV=1 42 251 9.0E-22
sp|Q1ILA1|RSMA_KORVE Ribosomal RNA small subunit methyltransferase A OS=Koribacter versatilis (strain Ellin345) GN=rsmA PE=3 SV=1 29 248 9.0E-22
sp|Q1JNI8|RSMA_STRPC Ribosomal RNA small subunit methyltransferase A OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rsmA PE=3 SV=1 36 248 1.0E-21
sp|Q1JDL6|RSMA_STRPB Ribosomal RNA small subunit methyltransferase A OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rsmA PE=3 SV=1 36 248 1.0E-21
sp|Q2RXA9|RSMA_RHORT Ribosomal RNA small subunit methyltransferase A OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rsmA PE=3 SV=1 31 259 1.0E-21
sp|A4IZF1|RSMA_FRATW Ribosomal RNA small subunit methyltransferase A OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rsmA PE=3 SV=1 41 249 1.0E-21
sp|Q0BKP7|RSMA_FRATO Ribosomal RNA small subunit methyltransferase A OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rsmA PE=3 SV=1 41 249 1.0E-21
sp|B2SDQ1|RSMA_FRATM Ribosomal RNA small subunit methyltransferase A OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rsmA PE=3 SV=1 41 249 1.0E-21
sp|Q2A218|RSMA_FRATH Ribosomal RNA small subunit methyltransferase A OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rsmA PE=3 SV=1 41 249 1.0E-21
sp|A7NDV3|RSMA_FRATF Ribosomal RNA small subunit methyltransferase A OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rsmA PE=3 SV=1 41 249 1.0E-21
sp|A6L1N4|RSMA_BACV8 Ribosomal RNA small subunit methyltransferase A OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rsmA PE=3 SV=1 42 251 1.0E-21
sp|B3DP38|RSMA_BIFLD Ribosomal RNA small subunit methyltransferase A OS=Bifidobacterium longum (strain DJO10A) GN=rsmA PE=3 SV=1 43 251 1.0E-21
sp|Q479U6|RSMA_DECAR Ribosomal RNA small subunit methyltransferase A OS=Dechloromonas aromatica (strain RCB) GN=rsmA PE=3 SV=1 43 249 1.0E-21
sp|Q2LSQ6|RSMA_SYNAS Ribosomal RNA small subunit methyltransferase A OS=Syntrophus aciditrophicus (strain SB) GN=rsmA PE=3 SV=1 32 248 1.0E-21
sp|Q8DXR8|RSMA_STRA5 Ribosomal RNA small subunit methyltransferase A OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rsmA PE=3 SV=1 36 248 1.0E-21
sp|Q48VC6|RSMA_STRPM Ribosomal RNA small subunit methyltransferase A OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rsmA PE=3 SV=1 36 248 1.0E-21
sp|Q1JIN6|RSMA_STRPD Ribosomal RNA small subunit methyltransferase A OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rsmA PE=3 SV=1 36 248 1.0E-21
sp|Q8A0H8|RSMA_BACTN Ribosomal RNA small subunit methyltransferase A OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rsmA PE=3 SV=1 42 251 1.0E-21
sp|Q0BC07|RSMA_BURCM Ribosomal RNA small subunit methyltransferase A OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rsmA PE=3 SV=1 43 259 1.0E-21
sp|Q03VR7|RSMA_LEUMM Ribosomal RNA small subunit methyltransferase A OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rsmA PE=3 SV=1 43 261 1.0E-21
sp|Q8PP25|RSMA_XANAC Ribosomal RNA small subunit methyltransferase A OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rsmA PE=3 SV=1 41 249 2.0E-21
sp|Q32K43|RSMA_SHIDS Ribosomal RNA small subunit methyltransferase A OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rsmA PE=3 SV=1 43 259 2.0E-21
sp|Q57TH0|RSMA_SALCH Ribosomal RNA small subunit methyltransferase A OS=Salmonella choleraesuis (strain SC-B67) GN=rsmA PE=3 SV=1 43 252 2.0E-21
sp|A7ZHE4|RSMA_ECO24 Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rsmA PE=3 SV=1 43 259 2.0E-21
sp|B4T6L6|RSMA_SALNS Ribosomal RNA small subunit methyltransferase A OS=Salmonella newport (strain SL254) GN=rsmA PE=3 SV=1 43 252 3.0E-21
sp|Q5GWB9|RSMA_XANOR Ribosomal RNA small subunit methyltransferase A OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rsmA PE=3 SV=1 41 249 3.0E-21
sp|B2SPT3|RSMA_XANOP Ribosomal RNA small subunit methyltransferase A OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rsmA PE=3 SV=1 41 249 3.0E-21
sp|Q2NZI4|RSMA_XANOM Ribosomal RNA small subunit methyltransferase A OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rsmA PE=3 SV=1 41 249 3.0E-21
sp|Q39W34|RSMA_GEOMG Ribosomal RNA small subunit methyltransferase A OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rsmA PE=3 SV=1 42 248 3.0E-21
sp|Q3JZA5|RSMA_STRA1 Ribosomal RNA small subunit methyltransferase A OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rsmA PE=3 SV=1 36 248 3.0E-21
sp|Q5F9W4|RSMA_NEIG1 Ribosomal RNA small subunit methyltransferase A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rsmA PE=3 SV=1 43 249 3.0E-21
sp|Q8Z9J7|RSMA_SALTI Ribosomal RNA small subunit methyltransferase A OS=Salmonella typhi GN=rsmA PE=3 SV=1 43 252 3.0E-21
sp|B5BL27|RSMA_SALPK Ribosomal RNA small subunit methyltransferase A OS=Salmonella paratyphi A (strain AKU_12601) GN=rsmA PE=3 SV=1 43 252 3.0E-21
sp|C0Q5E7|RSMA_SALPC Ribosomal RNA small subunit methyltransferase A OS=Salmonella paratyphi C (strain RKS4594) GN=rsmA PE=3 SV=1 43 252 3.0E-21
sp|A9MYM4|RSMA_SALPB Ribosomal RNA small subunit methyltransferase A OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rsmA PE=3 SV=1 43 252 3.0E-21
sp|Q5PDD9|RSMA_SALPA Ribosomal RNA small subunit methyltransferase A OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rsmA PE=3 SV=1 43 252 3.0E-21
sp|B4TJ47|RSMA_SALHS Ribosomal RNA small subunit methyltransferase A OS=Salmonella heidelberg (strain SL476) GN=rsmA PE=3 SV=1 43 252 3.0E-21
sp|B5RGC2|RSMA_SALG2 Ribosomal RNA small subunit methyltransferase A OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rsmA PE=3 SV=1 43 252 3.0E-21
sp|B5R1S8|RSMA_SALEP Ribosomal RNA small subunit methyltransferase A OS=Salmonella enteritidis PT4 (strain P125109) GN=rsmA PE=3 SV=1 43 252 3.0E-21
sp|B5FI34|RSMA_SALDC Ribosomal RNA small subunit methyltransferase A OS=Salmonella dublin (strain CT_02021853) GN=rsmA PE=3 SV=1 43 252 3.0E-21
sp|B5F771|RSMA_SALA4 Ribosomal RNA small subunit methyltransferase A OS=Salmonella agona (strain SL483) GN=rsmA PE=3 SV=1 43 252 3.0E-21
sp|A5FLP4|RSMA_FLAJ1 Ribosomal RNA small subunit methyltransferase A OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rsmA PE=3 SV=1 41 252 3.0E-21
sp|A8ALP9|RSMA_CITK8 Ribosomal RNA small subunit methyltransferase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rsmA PE=3 SV=1 43 259 3.0E-21
sp|A1S9G5|RSMA_SHEAM Ribosomal RNA small subunit methyltransferase A OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rsmA PE=3 SV=1 43 249 3.0E-21
sp|B7J2F3|RSMA_BORBZ Ribosomal RNA small subunit methyltransferase A OS=Borrelia burgdorferi (strain ZS7) GN=rsmA PE=3 SV=1 43 254 3.0E-21
sp|O51536|RSMA_BORBU Ribosomal RNA small subunit methyltransferase A OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rsmA PE=3 SV=1 43 254 3.0E-21
sp|B7L4H4|RSMA_ECO55 Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli (strain 55989 / EAEC) GN=rsmA PE=3 SV=1 43 259 3.0E-21
sp|B0URM7|RSMA_HISS2 Ribosomal RNA small subunit methyltransferase A OS=Histophilus somni (strain 2336) GN=rsmA PE=3 SV=1 43 249 4.0E-21
sp|Q0I5C3|RSMA_HAES1 Ribosomal RNA small subunit methyltransferase A OS=Haemophilus somnus (strain 129Pt) GN=rsmA PE=3 SV=1 43 249 4.0E-21
sp|Q9PPN8|RSMA_UREPA Ribosomal RNA small subunit methyltransferase A OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rsmA PE=3 SV=2 42 249 4.0E-21
sp|B1AJP2|RSMA_UREP2 Ribosomal RNA small subunit methyltransferase A OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rsmA PE=3 SV=1 42 249 4.0E-21
sp|Q83MG8|RSMA_SHIFL Ribosomal RNA small subunit methyltransferase A OS=Shigella flexneri GN=rsmA PE=3 SV=1 43 259 5.0E-21
sp|A7MIA7|RSMA_CROS8 Ribosomal RNA small subunit methyltransferase A OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rsmA PE=3 SV=1 43 252 5.0E-21
sp|Q11HG9|RSMA_CHESB Ribosomal RNA small subunit methyltransferase A OS=Chelativorans sp. (strain BNC1) GN=rsmA PE=3 SV=1 42 251 5.0E-21
sp|B5YZ89|RSMA_ECO5E Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rsmA PE=3 SV=1 43 259 5.0E-21
sp|Q8XA14|RSMA_ECO57 Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli O157:H7 GN=rsmA PE=3 SV=1 43 259 5.0E-21
sp|B1YWD5|RSMA_BURA4 Ribosomal RNA small subunit methyltransferase A OS=Burkholderia ambifaria (strain MC40-6) GN=rsmA PE=3 SV=1 43 259 5.0E-21
sp|A9MQG2|RSMA_SALAR Ribosomal RNA small subunit methyltransferase A OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rsmA PE=3 SV=1 43 252 5.0E-21
sp|A6T4I7|RSMA_KLEP7 Ribosomal RNA small subunit methyltransferase A OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rsmA PE=3 SV=1 43 259 5.0E-21
sp|B7MNR0|RSMA_ECO81 Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli O81 (strain ED1a) GN=rsmA PE=3 SV=1 43 259 5.0E-21
sp|A3MZB7|RSMA_ACTP2 Ribosomal RNA small subunit methyltransferase A OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rsmA PE=3 SV=1 43 249 6.0E-21
sp|Q5N2S8|RSMA_SYNP6 Ribosomal RNA small subunit methyltransferase A OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rsmA PE=3 SV=1 43 220 6.0E-21
sp|Q31RH6|RSMA_SYNE7 Ribosomal RNA small subunit methyltransferase A OS=Synechococcus elongatus (strain PCC 7942) GN=rsmA PE=3 SV=1 43 220 6.0E-21
sp|Q56016|RSMA_SALTY Ribosomal RNA small subunit methyltransferase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rsmA PE=3 SV=2 43 252 6.0E-21
sp|B6HZ32|RSMA_ECOSE Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli (strain SE11) GN=rsmA PE=3 SV=1 43 259 6.0E-21
sp|O84358|RSMA_CHLTR Ribosomal RNA small subunit methyltransferase A OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rsmA PE=3 SV=1 42 251 6.0E-21
sp|B0BBY8|RSMA_CHLTB Ribosomal RNA small subunit methyltransferase A OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rsmA PE=3 SV=1 42 251 6.0E-21
sp|Q3KM04|RSMA_CHLTA Ribosomal RNA small subunit methyltransferase A OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rsmA PE=3 SV=1 42 251 6.0E-21
sp|B0B7S3|RSMA_CHLT2 Ribosomal RNA small subunit methyltransferase A OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rsmA PE=3 SV=1 42 251 6.0E-21
sp|Q3BX82|RSMA_XANC5 Ribosomal RNA small subunit methyltransferase A OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rsmA PE=3 SV=1 41 249 6.0E-21
sp|Q660T2|RSMA_BORBP Ribosomal RNA small subunit methyltransferase A OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rsmA PE=3 SV=1 43 266 6.0E-21
sp|Q3Z5V8|RSMA_SHISS Ribosomal RNA small subunit methyltransferase A OS=Shigella sonnei (strain Ss046) GN=rsmA PE=3 SV=1 43 259 6.0E-21
sp|Q0T8E4|RSMA_SHIF8 Ribosomal RNA small subunit methyltransferase A OS=Shigella flexneri serotype 5b (strain 8401) GN=rsmA PE=3 SV=1 43 259 6.0E-21
sp|Q326I2|RSMA_SHIBS Ribosomal RNA small subunit methyltransferase A OS=Shigella boydii serotype 4 (strain Sb227) GN=rsmA PE=3 SV=1 43 259 6.0E-21
sp|B1LFY7|RSMA_ECOSM Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rsmA PE=3 SV=1 43 259 6.0E-21
sp|P06992|RSMA_ECOLI Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli (strain K12) GN=rsmA PE=1 SV=1 43 259 6.0E-21
sp|B1IRC5|RSMA_ECOLC Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rsmA PE=3 SV=1 43 259 6.0E-21
sp|A7ZW03|RSMA_ECOHS Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli O9:H4 (strain HS) GN=rsmA PE=3 SV=1 43 259 6.0E-21
sp|B1XC52|RSMA_ECODH Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli (strain K12 / DH10B) GN=rsmA PE=3 SV=1 43 259 6.0E-21
sp|C4ZPX7|RSMA_ECOBW Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rsmA PE=3 SV=1 43 259 6.0E-21
sp|B7M0E8|RSMA_ECO8A Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli O8 (strain IAI1) GN=rsmA PE=3 SV=1 43 259 6.0E-21
sp|B7NHF7|RSMA_ECO7I Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rsmA PE=3 SV=1 43 259 6.0E-21
sp|B2U259|RSMA_SHIB3 Ribosomal RNA small subunit methyltransferase A OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rsmA PE=3 SV=1 43 259 6.0E-21
sp|B3H0R3|RSMA_ACTP7 Ribosomal RNA small subunit methyltransferase A OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rsmA PE=3 SV=1 43 249 6.0E-21
sp|A1KSW0|RSMA_NEIMF Ribosomal RNA small subunit methyltransferase A OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rsmA PE=3 SV=1 43 249 7.0E-21
sp|B5Y1Z4|RSMA_KLEP3 Ribosomal RNA small subunit methyltransferase A OS=Klebsiella pneumoniae (strain 342) GN=rsmA PE=3 SV=1 43 259 7.0E-21
sp|A6GVR5|RSMA_FLAPJ Ribosomal RNA small subunit methyltransferase A OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rsmA PE=3 SV=1 41 252 7.0E-21
sp|Q9K0B7|RSMA_NEIMB Ribosomal RNA small subunit methyltransferase A OS=Neisseria meningitidis serogroup B (strain MC58) GN=rsmA PE=3 SV=1 43 249 7.0E-21
sp|Q1WV73|RSMA_LACS1 Ribosomal RNA small subunit methyltransferase A OS=Lactobacillus salivarius (strain UCC118) GN=rsmA PE=3 SV=1 36 248 7.0E-21
sp|Q5M2L6|RSMA_STRT2 Ribosomal RNA small subunit methyltransferase A OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rsmA PE=3 SV=1 36 248 8.0E-21
sp|Q9JVC2|RSMA_NEIMA Ribosomal RNA small subunit methyltransferase A OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rsmA PE=3 SV=1 43 249 8.0E-21
sp|Q03HF6|RSMA_PEDPA Ribosomal RNA small subunit methyltransferase A OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rsmA PE=3 SV=1 41 248 8.0E-21
sp|B5EL84|RSMA_ACIF5 Ribosomal RNA small subunit methyltransferase A OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rsmA PE=3 SV=1 43 248 8.0E-21
sp|A2SC77|RSMA_METPP Ribosomal RNA small subunit methyltransferase A OS=Methylibium petroleiphilum (strain PM1) GN=rsmA PE=3 SV=1 43 257 8.0E-21
sp|B2JCX3|RSMA_BURP8 Ribosomal RNA small subunit methyltransferase A OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rsmA PE=3 SV=1 43 249 8.0E-21
sp|B2G5I8|RSMA_LACRJ Ribosomal RNA small subunit methyltransferase A OS=Lactobacillus reuteri (strain JCM 1112) GN=rsmA PE=3 SV=1 43 248 8.0E-21
sp|A5VI09|RSMA_LACRD Ribosomal RNA small subunit methyltransferase A OS=Lactobacillus reuteri (strain DSM 20016) GN=rsmA PE=3 SV=1 43 248 8.0E-21
sp|B7J3R3|RSMA_ACIF2 Ribosomal RNA small subunit methyltransferase A OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rsmA PE=3 SV=1 43 248 8.0E-21
sp|Q1RGE6|RSMA_ECOUT Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli (strain UTI89 / UPEC) GN=rsmA PE=3 SV=1 43 259 9.0E-21
sp|Q8FL96|RSMA_ECOL6 Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rsmA PE=3 SV=1 43 259 9.0E-21
sp|Q0TLT6|RSMA_ECOL5 Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rsmA PE=3 SV=1 43 259 9.0E-21
sp|A1A7A0|RSMA_ECOK1 Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli O1:K1 / APEC GN=rsmA PE=3 SV=1 43 259 9.0E-21
sp|B7MAH6|RSMA_ECO45 Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rsmA PE=3 SV=1 43 259 9.0E-21
sp|B7UI99|RSMA_ECO27 Ribosomal RNA small subunit methyltransferase A OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rsmA PE=3 SV=1 43 259 9.0E-21
sp|Q145L1|RSMA_BURXL Ribosomal RNA small subunit methyltransferase A OS=Burkholderia xenovorans (strain LB400) GN=rsmA PE=3 SV=1 43 257 1.0E-20
sp|A4JHP7|RSMA_BURVG Ribosomal RNA small subunit methyltransferase A OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rsmA PE=3 SV=1 43 249 1.0E-20
sp|Q7VQK3|RSMA_BLOFL Ribosomal RNA small subunit methyltransferase A OS=Blochmannia floridanus GN=rsmA PE=3 SV=1 43 259 1.0E-20
sp|B7LVU5|RSMA_ESCF3 Ribosomal RNA small subunit methyltransferase A OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rsmA PE=3 SV=1 43 259 1.0E-20
sp|Q65UX3|RSMA_MANSM Ribosomal RNA small subunit methyltransferase A OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rsmA PE=3 SV=1 43 259 1.0E-20
sp|B4RJV5|RSMA_NEIG2 Ribosomal RNA small subunit methyltransferase A OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rsmA PE=3 SV=1 43 249 1.0E-20
sp|O65090|DIM1C_ARATH Ribosomal RNA small subunit methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=PFC1 PE=2 SV=1 41 252 1.0E-20
sp|A9M352|RSMA_NEIM0 Ribosomal RNA small subunit methyltransferase A OS=Neisseria meningitidis serogroup C (strain 053442) GN=rsmA PE=3 SV=1 43 249 1.0E-20
sp|Q1AXL9|RSMA_RUBXD Ribosomal RNA small subunit methyltransferase A OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rsmA PE=3 SV=1 41 218 1.0E-20
sp|Q9RU68|RSMA_DEIRA Ribosomal RNA small subunit methyltransferase A OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rsmA PE=3 SV=2 36 249 1.0E-20
sp|Q6ME80|RSMA_PARUW Ribosomal RNA small subunit methyltransferase A OS=Protochlamydia amoebophila (strain UWE25) GN=rsmA PE=3 SV=2 42 252 1.0E-20
sp|A3CQN5|RSMA_STRSV Ribosomal RNA small subunit methyltransferase A OS=Streptococcus sanguinis (strain SK36) GN=rsmA PE=3 SV=1 36 257 1.0E-20
sp|Q5FU61|RSMA_GLUOX Ribosomal RNA small subunit methyltransferase A OS=Gluconobacter oxydans (strain 621H) GN=rsmA PE=3 SV=1 41 263 1.0E-20
sp|B0BTQ4|RSMA_ACTPJ Ribosomal RNA small subunit methyltransferase A OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rsmA PE=3 SV=1 43 249 1.0E-20
sp|A6W6U4|RSMA_KINRD Ribosomal RNA small subunit methyltransferase A OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rsmA PE=3 SV=1 41 254 1.0E-20
sp|A9AFE4|RSMA_BURM1 Ribosomal RNA small subunit methyltransferase A OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rsmA PE=3 SV=1 43 259 1.0E-20
sp|A8LI73|RSMA_DINSH Ribosomal RNA small subunit methyltransferase A OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rsmA PE=3 SV=1 31 254 1.0E-20
sp|B9DVT4|RSMA_STRU0 Ribosomal RNA small subunit methyltransferase A OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rsmA PE=3 SV=1 36 248 2.0E-20
sp|Q04720|ERMJ_BACAN rRNA adenine N-6-methyltransferase OS=Bacillus anthracis GN=ermJ PE=3 SV=1 43 226 2.0E-20
sp|Q03986|ERMD_BACLI rRNA adenine N-6-methyltransferase OS=Bacillus licheniformis GN=ermD PE=2 SV=1 43 226 2.0E-20
sp|Q5LY12|RSMA_STRT1 Ribosomal RNA small subunit methyltransferase A OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rsmA PE=3 SV=1 36 248 2.0E-20
sp|Q2YVV2|RSMA_STAAB Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rsmA PE=3 SV=2 36 252 2.0E-20
sp|P66663|RSMA_STAAW Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus aureus (strain MW2) GN=rsmA PE=3 SV=1 36 252 2.0E-20
sp|A8Z0Y8|RSMA_STAAT Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rsmA PE=3 SV=1 36 252 2.0E-20
sp|Q6GBZ5|RSMA_STAAS Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus aureus (strain MSSA476) GN=rsmA PE=3 SV=1 36 252 2.0E-20
sp|P66662|RSMA_STAAN Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus aureus (strain N315) GN=rsmA PE=1 SV=1 36 252 2.0E-20
sp|Q932G1|RSMA_STAAM Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rsmA PE=3 SV=3 36 252 2.0E-20
sp|Q5HII3|RSMA_STAAC Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus aureus (strain COL) GN=rsmA PE=3 SV=1 36 252 2.0E-20
sp|A5IQ45|RSMA_STAA9 Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus aureus (strain JH9) GN=rsmA PE=3 SV=1 36 252 2.0E-20
sp|Q2G0T0|RSMA_STAA8 Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus aureus (strain NCTC 8325) GN=rsmA PE=3 SV=1 36 252 2.0E-20
sp|Q2FJE9|RSMA_STAA3 Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus aureus (strain USA300) GN=rsmA PE=3 SV=1 36 252 2.0E-20
sp|A6TYW7|RSMA_STAA2 Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus aureus (strain JH1) GN=rsmA PE=3 SV=1 36 252 2.0E-20
sp|A7WYP0|RSMA_STAA1 Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rsmA PE=3 SV=1 36 252 2.0E-20
sp|A6QEE6|RSMA_STAAE Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus aureus (strain Newman) GN=rsmA PE=3 SV=1 36 252 2.0E-20
sp|Q6GJH8|RSMA_STAAR Ribosomal RNA small subunit methyltransferase A OS=Staphylococcus aureus (strain MRSA252) GN=rsmA PE=3 SV=1 36 252 2.0E-20
sp|Q5NHI5|RSMA_FRATT Ribosomal RNA small subunit methyltransferase A OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rsmA PE=3 SV=1 41 249 2.0E-20
sp|Q14IY7|RSMA_FRAT1 Ribosomal RNA small subunit methyltransferase A OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rsmA PE=3 SV=1 41 249 2.0E-20
sp|Q7VCH7|RSMA_PROMA Ribosomal RNA small subunit methyltransferase A OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rsmA PE=3 SV=1 43 249 2.0E-20
sp|A4G256|RSMA_HERAR Ribosomal RNA small subunit methyltransferase A OS=Herminiimonas arsenicoxydans GN=rsmA PE=3 SV=1 43 219 3.0E-20
sp|Q9CLL5|RSMA_PASMU Ribosomal RNA small subunit methyltransferase A OS=Pasteurella multocida (strain Pm70) GN=rsmA PE=3 SV=1 43 249 3.0E-20
sp|Q837A7|RSMA_ENTFA Ribosomal RNA small subunit methyltransferase A OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rsmA PE=3 SV=1 32 248 3.0E-20
sp|Q2GGH6|RSMA_EHRCR Ribosomal RNA small subunit methyltransferase A OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rsmA PE=3 SV=2 33 251 4.0E-20
sp|B2SX63|RSMA_BURPP Ribosomal RNA small subunit methyltransferase A OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rsmA PE=3 SV=1 43 279 4.0E-20
sp|A1WVT7|RSMA_HALHL Ribosomal RNA small subunit methyltransferase A OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rsmA PE=3 SV=1 43 254 4.0E-20
sp|A8AUQ4|RSMA_STRGC Ribosomal RNA small subunit methyltransferase A OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rsmA PE=3 SV=1 36 257 4.0E-20
sp|Q2N8W9|RSMA_ERYLH Ribosomal RNA small subunit methyltransferase A OS=Erythrobacter litoralis (strain HTCC2594) GN=rsmA PE=3 SV=1 42 254 5.0E-20
sp|C6BSW3|RSMA_DESAD Ribosomal RNA small subunit methyltransferase A OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rsmA PE=3 SV=1 41 248 6.0E-20
sp|Q68W66|RSMA_RICTY Ribosomal RNA small subunit methyltransferase A OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rsmA PE=3 SV=1 43 252 6.0E-20
sp|A6SV13|RSMA_JANMA Ribosomal RNA small subunit methyltransferase A OS=Janthinobacterium sp. (strain Marseille) GN=rsmA PE=3 SV=1 43 219 6.0E-20
sp|Q3YS70|RSMA_EHRCJ Ribosomal RNA small subunit methyltransferase A OS=Ehrlichia canis (strain Jake) GN=rsmA PE=3 SV=1 42 251 6.0E-20
sp|Q03IR2|RSMA_STRTD Ribosomal RNA small subunit methyltransferase A OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rsmA PE=3 SV=1 36 248 7.0E-20
sp|Q74C12|RSMA_GEOSL Ribosomal RNA small subunit methyltransferase A OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rsmA PE=3 SV=1 42 248 7.0E-20
sp|Q2YBP5|RSMA_NITMU Ribosomal RNA small subunit methyltransferase A OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rsmA PE=3 SV=1 43 252 7.0E-20
sp|Q6MUM4|RSMA_MYCMS Ribosomal RNA small subunit methyltransferase A OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rsmA PE=3 SV=1 43 247 9.0E-20
sp|A4W6F7|RSMA_ENT38 Ribosomal RNA small subunit methyltransferase A OS=Enterobacter sp. (strain 638) GN=rsmA PE=3 SV=1 43 263 9.0E-20
sp|Q0SMR8|RSMA_BORAP Ribosomal RNA small subunit methyltransferase A OS=Borrelia afzelii (strain PKo) GN=rsmA PE=3 SV=1 43 266 9.0E-20
sp|Q03T56|RSMA_LACBA Ribosomal RNA small subunit methyltransferase A OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rsmA PE=3 SV=1 41 248 1.0E-19
sp|A0QBW0|RSMA_MYCA1 Ribosomal RNA small subunit methyltransferase A OS=Mycobacterium avium (strain 104) GN=rsmA PE=3 SV=1 36 218 1.0E-19
sp|A0AEZ3|RSMA_LISW6 Ribosomal RNA small subunit methyltransferase A OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rsmA PE=3 SV=1 36 248 1.0E-19
sp|P59156|RSMA_STRMU Ribosomal RNA small subunit methyltransferase A OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rsmA PE=3 SV=1 36 248 1.0E-19
sp|P9WH07|RSMA_MYCTU Ribosomal RNA small subunit methyltransferase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ksgA PE=1 SV=1 36 255 1.0E-19
sp|P9WH06|RSMA_MYCTO Ribosomal RNA small subunit methyltransferase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ksgA PE=3 SV=1 36 255 1.0E-19
sp|A5U153|RSMA_MYCTA Ribosomal RNA small subunit methyltransferase A OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=rsmA PE=3 SV=1 36 255 1.0E-19
sp|C1AM01|RSMA_MYCBT Ribosomal RNA small subunit methyltransferase A OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rsmA PE=3 SV=1 36 255 1.0E-19
sp|A1KHE8|RSMA_MYCBP Ribosomal RNA small subunit methyltransferase A OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rsmA PE=3 SV=1 36 255 1.0E-19
sp|P66661|RSMA_MYCBO Ribosomal RNA small subunit methyltransferase A OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=rsmA PE=3 SV=1 36 255 1.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10832
MAKSKHVKRSGAFNSPYDRPSGSKAGGTGAGKNNVFKFNTNVGQHILKNPGVSDAIVDKAYLKPTDTVLEVGPGT
GNLTVRILEKAKKCICVELDPRMAAEVTKRVQGKPEQRKLEVLLGDVIKTELPAFDVCISNTPYQISSPLVFKLL
AMPNPPRTSILMFQREFALRLTARPGDTLYCRLSVNAQFWAKITHVMKVGKNNFKPPPQVESSVVRIEPKMGKDR
PNVSWDEWDGLLRVCFVRKNKTLRASWLGTKEVLAMVERNYRTWCAMNGVPVDESLVEDDDADNDADVDADGGAE
GDSMDVDDDDDAPDFFKELPGPAPKTKSKRQKTKVAQLVREKMRKVLEDVTELADKRAGKCDENDFLRLLFAFNQ
EGIHFS*
Coding >Hirsu2|10832
ATGGCGAAAAGTAAACACGTCAAGCGCAGCGGCGCGTTCAACTCCCCCTACGACCGACCGAGCGGGAGCAAAGCC
GGCGGCACAGGCGCCGGCAAGAACAACGTCTTCAAGTTCAACACCAACGTCGGCCAGCACATACTGAAGAACCCC
GGCGTGTCGGACGCCATCGTCGACAAGGCCTACCTCAAGCCCACGGACACGGTGCTGGAAGTCGGCCCCGGAACC
GGCAATCTGACGGTGCGCATCCTGGAAAAGGCCAAGAAATGCATCTGCGTCGAGCTGGATCCGAGGATGGCGGCC
GAGGTCACCAAGCGGGTGCAGGGGAAGCCCGAGCAGCGCAAGCTCGAGGTGCTGCTCGGGGACGTCATCAAGACT
GAGCTTCCCGCATTTGACGTCTGCATCTCCAACACCCCGTATCAAATCTCTTCCCCTCTCGTCTTCAAGCTGCTC
GCCATGCCCAACCCGCCGCGGACGTCGATCCTCATGTTCCAGCGCGAATTCGCCCTGCGCCTCACCGCCCGCCCC
GGCGACACGCTGTATTGCCGCCTCTCGGTCAACGCCCAGTTCTGGGCCAAGATCACGCACGTCATGAAGGTCGGC
AAGAACAACTTCAAGCCCCCTCCGCAGGTCGAGTCGTCGGTGGTCCGCATCGAGCCCAAGATGGGCAAGGACCGG
CCCAACGTCAGCTGGGACGAGTGGGACGGCCTGCTGCGCGTCTGCTTCGTCCGCAAGAACAAGACGCTGCGCGCC
AGCTGGCTCGGAACCAAGGAGGTGCTGGCCATGGTCGAGAGGAACTACCGCACCTGGTGCGCCATGAACGGCGTG
CCCGTCGACGAGAGCCTGGTGGAGGACGACGACGCCGACAACGACGCCGACGTCGACGCCGATGGAGGCGCCGAG
GGCGACAGCATGGACGTCGATGACGACGACGACGCCCCCGACTTCTTCAAGGAGCTGCCCGGCCCCGCGCCCAAG
ACCAAGAGCAAGCGCCAAAAGACAAAGGTGGCCCAGCTCGTGCGCGAGAAGATGCGCAAGGTGCTGGAAGACGTG
ACCGAGCTGGCTGACAAGCGCGCCGGCAAGTGCGACGAGAACGACTTTCTGCGCCTGCTCTTCGCCTTCAACCAG
GAGGGCATTCACTTCTCCTAG
Transcript >Hirsu2|10832
ATGGCGAAAAGTAAACACGTCAAGCGCAGCGGCGCGTTCAACTCCCCCTACGACCGACCGAGCGGGAGCAAAGCC
GGCGGCACAGGCGCCGGCAAGAACAACGTCTTCAAGTTCAACACCAACGTCGGCCAGCACATACTGAAGAACCCC
GGCGTGTCGGACGCCATCGTCGACAAGGCCTACCTCAAGCCCACGGACACGGTGCTGGAAGTCGGCCCCGGAACC
GGCAATCTGACGGTGCGCATCCTGGAAAAGGCCAAGAAATGCATCTGCGTCGAGCTGGATCCGAGGATGGCGGCC
GAGGTCACCAAGCGGGTGCAGGGGAAGCCCGAGCAGCGCAAGCTCGAGGTGCTGCTCGGGGACGTCATCAAGACT
GAGCTTCCCGCATTTGACGTCTGCATCTCCAACACCCCGTATCAAATCTCTTCCCCTCTCGTCTTCAAGCTGCTC
GCCATGCCCAACCCGCCGCGGACGTCGATCCTCATGTTCCAGCGCGAATTCGCCCTGCGCCTCACCGCCCGCCCC
GGCGACACGCTGTATTGCCGCCTCTCGGTCAACGCCCAGTTCTGGGCCAAGATCACGCACGTCATGAAGGTCGGC
AAGAACAACTTCAAGCCCCCTCCGCAGGTCGAGTCGTCGGTGGTCCGCATCGAGCCCAAGATGGGCAAGGACCGG
CCCAACGTCAGCTGGGACGAGTGGGACGGCCTGCTGCGCGTCTGCTTCGTCCGCAAGAACAAGACGCTGCGCGCC
AGCTGGCTCGGAACCAAGGAGGTGCTGGCCATGGTCGAGAGGAACTACCGCACCTGGTGCGCCATGAACGGCGTG
CCCGTCGACGAGAGCCTGGTGGAGGACGACGACGCCGACAACGACGCCGACGTCGACGCCGATGGAGGCGCCGAG
GGCGACAGCATGGACGTCGATGACGACGACGACGCCCCCGACTTCTTCAAGGAGCTGCCCGGCCCCGCGCCCAAG
ACCAAGAGCAAGCGCCAAAAGACAAAGGTGGCCCAGCTCGTGCGCGAGAAGATGCGCAAGGTGCTGGAAGACGTG
ACCGAGCTGGCTGACAAGCGCGCCGGCAAGTGCGACGAGAACGACTTTCTGCGCCTGCTCTTCGCCTTCAACCAG
GAGGGCATTCACTTCTCCTAG
Gene >Hirsu2|10832
ATGGCGAAAAGTAAACACGTCAAGCGCAGCGGCGCGTTCAACTCCCCCTACGACCGACCGAGCGGGAGCAAAGCC
GGCGGCACAGGCGCCGGCAAGAACAACGTCTTCAAGTTCAACACCAACGTCGGCCAGCACATACTGAAGAACCCC
GGCGTGTCGGACGCCATCGTCGACAAGGCCTACCTCAAGCCCACGGACACGGTGCTGGAAGTCGGCCCCGGAACC
GGCAATCTGACGGTGCGCATCCTGGAAAAGGCCAAGAAATGCATCTGCGTCGAGCTGGATCCGAGGATGGCGGCC
GAGGTCACCAAGCGGGTGCAGGGGAAGCCCGAGCAGCGCAAGCTCGAGGTGCTGCTCGGGGACGTCATCAAGACT
GAGCTTCCCGCATTTGACGTCTGCATCTCCAACACCCCGTATCAAGTATGTTGGGGCCCGTGAGAAGGCGTTCTC
TCCCATATCGAGCCGTCCCCCGTTGACGGGCCGCTGTCCAGATCTCTTCCCCTCTCGTCTTCAAGCTGCTCGCCA
TGCCCAACCCGCCGCGGACGTCGATCCTCATGTTCCAGCGCGAATTCGCCCTGCGCCTCACCGCCCGCCCCGGCG
ACACGCTGTATTGCCGCCTCTCGGTCAACGCCCAGTTCTGGGCCAAGATCACGCACGTCATGAAGGTCGGCAAGA
ACAACTTCAAGCCCCCTCCGCAGGTCGAGTCGTCGGTGGTCCGCATCGAGCCCAAGATGGGCAAGGACCGGCCCA
ACGTCAGCTGGGACGAGTGGGACGGCCTGCTGCGCGTCTGCTTCGTCCGCAAGAACAAGACGCTGCGCGCCAGCT
GGCTCGGAACCAAGGAGGTGCTGGCCATGGTCGAGAGGAACTACCGCACCTGGTGCGCCATGAACGGCGTGCCCG
TCGACGAGAGCCTGGTGGAGGACGACGACGCCGACAACGACGCCGACGTCGACGCCGATGGAGGCGCCGAGGGCG
ACAGCATGGACGTCGATGACGACGACGACGCCCCCGACTTCTTCAAGGAGCTGCCCGGCCCCGCGCCCAAGACCA
AGAGCAAGCGCCAAAAGACAAAGGTGGCCCAGCTCGTGCGCGAGAAGATGCGCAAGGTGCTGGAAGACGTGACCG
AGCTGGCTGACAAGCGCGCCGGCAAGTGCGACGAGAACGACTTTCTGCGCCTGCTCTTCGCCTTCAACCAGGAGG
GCATTCACTTCTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail