Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10828
Gene name
LocationContig_91:14160..16158
Strand+
Gene length (bp)1998
Transcript length (bp)1998
Coding sequence length (bp)1998
Protein length (aa) 666

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 2.0E-27 276 611
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 1.5E-09 328 490
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 9.6E-07 332 537

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 178 610 3.0E-22
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 178 614 7.0E-22
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 190 584 4.0E-19
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 192 518 1.0E-15
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 276 610 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 178 610 3.0E-22
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 178 614 7.0E-22
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 190 584 4.0E-19
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 192 518 1.0E-15
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 276 610 2.0E-15
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 192 496 3.0E-15
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 165 610 8.0E-15
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 192 559 4.0E-13
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 192 496 4.0E-13
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 192 579 6.0E-13
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 277 519 7.0E-13
sp|P78746|CHSD_ASPFU Chitin synthase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsD PE=3 SV=1 332 610 9.0E-10
sp|P04341|NODC_RHIME N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) GN=nodC PE=3 SV=1 330 515 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 123 156 33
2 161 180 19
3 493 515 22
4 544 566 22
5 579 601 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10828
MSADILPRPVTAVTREQAWKTTRPWRYRPSTQPRVLPLNEPTLDAPRSGFQTQSARAATSDGSKIQEKTSFFDDR
SVSRDGSTGRDIEKSAPCRAAPAGWPVQPAPVDGSRKLTRTELRVQRVVFIAFVLAVNLGLAAVTVFGKVGLATL
VIILFFKTQDCLCVLVSAVCLAWTTVAGLFRKPEPLSRRWILSLLPAYNESEEQILRSIQGLRKNVQEPHRQVVA
IVLDGQPKEIKHEFSHIVADFERPYHSLKHKVGTLKVTAGFFDDLPVIMIEKAQNSGKKDSLVLTHDLFNHPRKN
MPAYSRFLREELWTNVLPLLTAGTDFGAFDMVFCTDADSVIHDGCIMKLTDRLARDGKAIAACGLVLVEFEPGHE
WSFWNFFQLLQYAYGQFVRRWAEGFVGKVTCLPGCVTMIAVREEMAGAIAKFARPVKEDWVLHHQVQNLGTDRRL
TYCMLSQGKKLRTLFVPDALSETVAPQSFKHYLHQRRRWGSNAYFNNFFYFAGVKMILFTRFIAFLHILRQTCVY
YRVLNTILFIRCLVLHFNIMDILPLLVVGQLPGLWFCICLLIQRSLRVRIHKIIVGWLLNKIVSPIMSSIVFAAV
VTNLGNAVWGMSGITASSTSTISPRPQTQSTMTSKPSSSAGSKPPSSAGSKPPSSAGNKPPTLPG*
Coding >Hirsu2|10828
ATGTCTGCCGATATCCTTCCCCGGCCTGTGACCGCAGTCACACGGGAGCAGGCCTGGAAGACAACAAGACCGTGG
CGGTACAGACCCAGCACACAACCACGAGTTCTGCCACTTAACGAGCCTACACTCGATGCACCGCGGTCCGGCTTT
CAAACACAGAGTGCGAGAGCGGCTACATCGGACGGCAGCAAGATTCAGGAGAAGACGTCTTTTTTCGACGACCGC
TCCGTTTCTCGAGACGGGAGCACCGGCCGCGATATCGAAAAGTCGGCGCCCTGCCGGGCCGCGCCAGCCGGCTGG
CCCGTCCAGCCGGCCCCCGTCGACGGCTCGAGAAAGCTGACGAGGACCGAGCTCCGCGTCCAGCGCGTCGTCTTC
ATCGCCTTCGTCCTGGCCGTCAACCTCGGGCTGGCCGCCGTCACCGTCTTCGGCAAGGTCGGGCTTGCGACGCTC
GTCATCATCCTGTTCTTCAAGACGCAGGACTGCCTCTGCGTCCTCGTCTCGGCCGTCTGCCTGGCCTGGACGACG
GTGGCGGGCCTGTTCCGCAAGCCGGAGCCCCTGTCCCGGCGCTGGATCCTGTCTCTCCTGCCGGCGTACAACGAG
AGCGAGGAGCAGATCCTCCGATCGATCCAGGGCCTGCGCAAGAACGTGCAGGAGCCGCACCGGCAGGTCGTCGCC
ATCGTGCTCGACGGCCAGCCCAAGGAGATCAAGCACGAGTTCTCGCACATCGTGGCCGACTTCGAGCGCCCGTAC
CACTCGCTCAAGCACAAGGTCGGCACGCTCAAGGTCACGGCCGGCTTCTTCGACGACCTGCCGGTCATCATGATC
GAAAAGGCGCAGAACAGCGGCAAGAAGGACAGCTTGGTCCTGACGCACGACCTCTTCAACCACCCGCGCAAGAAC
ATGCCGGCCTATAGCCGCTTCCTGCGCGAGGAGCTCTGGACCAACGTCCTGCCGCTGCTCACGGCCGGCACCGAC
TTCGGCGCCTTCGACATGGTCTTCTGCACCGACGCCGACTCCGTCATCCACGACGGCTGCATCATGAAGCTGACC
GACCGCCTGGCCCGTGACGGCAAGGCCATCGCCGCCTGCGGCCTCGTCCTCGTCGAGTTCGAGCCGGGCCACGAG
TGGTCCTTCTGGAACTTCTTCCAGCTGCTGCAGTACGCCTACGGCCAGTTCGTCCGCCGCTGGGCCGAGGGCTTC
GTCGGAAAGGTCACCTGCCTGCCGGGGTGCGTCACCATGATCGCCGTCCGCGAGGAGATGGCCGGCGCCATCGCC
AAGTTCGCCCGCCCGGTCAAGGAGGACTGGGTGCTCCATCACCAGGTCCAAAATCTGGGCACCGACCGCCGACTG
ACGTACTGCATGCTGAGCCAAGGGAAGAAGCTGCGTACTCTCTTCGTCCCGGACGCCCTCTCCGAGACGGTCGCC
CCCCAGTCCTTCAAGCACTACCTGCACCAGCGCCGTCGTTGGGGCTCCAACGCCTACTTCAACAACTTCTTCTAC
TTCGCCGGCGTCAAGATGATCCTCTTCACTCGTTTCATTGCCTTTCTCCACATCCTGCGCCAGACGTGCGTTTAC
TATCGTGTCCTCAACACCATTCTCTTCATCCGCTGCCTCGTTCTTCACTTCAACATCATGGACATCCTGCCACTC
TTGGTCGTCGGCCAGCTTCCGGGCCTGTGGTTCTGCATCTGTCTGCTGATCCAGCGCTCCCTGCGGGTCAGGATA
CACAAGATCATTGTCGGTTGGCTTCTGAATAAAATCGTCTCGCCAATCATGTCTTCCATCGTCTTCGCCGCCGTG
GTGACAAACCTGGGGAATGCGGTCTGGGGAATGAGCGGAATCACGGCCTCCTCGACTTCTACGATATCCCCGCGG
CCGCAGACGCAGTCCACCATGACCAGCAAGCCGTCGTCTTCGGCCGGCAGCAAGCCGCCGTCTTCGGCCGGCAGC
AAGCCGCCATCTTCAGCCGGCAACAAGCCGCCAACTCTACCGGGCTAG
Transcript >Hirsu2|10828
ATGTCTGCCGATATCCTTCCCCGGCCTGTGACCGCAGTCACACGGGAGCAGGCCTGGAAGACAACAAGACCGTGG
CGGTACAGACCCAGCACACAACCACGAGTTCTGCCACTTAACGAGCCTACACTCGATGCACCGCGGTCCGGCTTT
CAAACACAGAGTGCGAGAGCGGCTACATCGGACGGCAGCAAGATTCAGGAGAAGACGTCTTTTTTCGACGACCGC
TCCGTTTCTCGAGACGGGAGCACCGGCCGCGATATCGAAAAGTCGGCGCCCTGCCGGGCCGCGCCAGCCGGCTGG
CCCGTCCAGCCGGCCCCCGTCGACGGCTCGAGAAAGCTGACGAGGACCGAGCTCCGCGTCCAGCGCGTCGTCTTC
ATCGCCTTCGTCCTGGCCGTCAACCTCGGGCTGGCCGCCGTCACCGTCTTCGGCAAGGTCGGGCTTGCGACGCTC
GTCATCATCCTGTTCTTCAAGACGCAGGACTGCCTCTGCGTCCTCGTCTCGGCCGTCTGCCTGGCCTGGACGACG
GTGGCGGGCCTGTTCCGCAAGCCGGAGCCCCTGTCCCGGCGCTGGATCCTGTCTCTCCTGCCGGCGTACAACGAG
AGCGAGGAGCAGATCCTCCGATCGATCCAGGGCCTGCGCAAGAACGTGCAGGAGCCGCACCGGCAGGTCGTCGCC
ATCGTGCTCGACGGCCAGCCCAAGGAGATCAAGCACGAGTTCTCGCACATCGTGGCCGACTTCGAGCGCCCGTAC
CACTCGCTCAAGCACAAGGTCGGCACGCTCAAGGTCACGGCCGGCTTCTTCGACGACCTGCCGGTCATCATGATC
GAAAAGGCGCAGAACAGCGGCAAGAAGGACAGCTTGGTCCTGACGCACGACCTCTTCAACCACCCGCGCAAGAAC
ATGCCGGCCTATAGCCGCTTCCTGCGCGAGGAGCTCTGGACCAACGTCCTGCCGCTGCTCACGGCCGGCACCGAC
TTCGGCGCCTTCGACATGGTCTTCTGCACCGACGCCGACTCCGTCATCCACGACGGCTGCATCATGAAGCTGACC
GACCGCCTGGCCCGTGACGGCAAGGCCATCGCCGCCTGCGGCCTCGTCCTCGTCGAGTTCGAGCCGGGCCACGAG
TGGTCCTTCTGGAACTTCTTCCAGCTGCTGCAGTACGCCTACGGCCAGTTCGTCCGCCGCTGGGCCGAGGGCTTC
GTCGGAAAGGTCACCTGCCTGCCGGGGTGCGTCACCATGATCGCCGTCCGCGAGGAGATGGCCGGCGCCATCGCC
AAGTTCGCCCGCCCGGTCAAGGAGGACTGGGTGCTCCATCACCAGGTCCAAAATCTGGGCACCGACCGCCGACTG
ACGTACTGCATGCTGAGCCAAGGGAAGAAGCTGCGTACTCTCTTCGTCCCGGACGCCCTCTCCGAGACGGTCGCC
CCCCAGTCCTTCAAGCACTACCTGCACCAGCGCCGTCGTTGGGGCTCCAACGCCTACTTCAACAACTTCTTCTAC
TTCGCCGGCGTCAAGATGATCCTCTTCACTCGTTTCATTGCCTTTCTCCACATCCTGCGCCAGACGTGCGTTTAC
TATCGTGTCCTCAACACCATTCTCTTCATCCGCTGCCTCGTTCTTCACTTCAACATCATGGACATCCTGCCACTC
TTGGTCGTCGGCCAGCTTCCGGGCCTGTGGTTCTGCATCTGTCTGCTGATCCAGCGCTCCCTGCGGGTCAGGATA
CACAAGATCATTGTCGGTTGGCTTCTGAATAAAATCGTCTCGCCAATCATGTCTTCCATCGTCTTCGCCGCCGTG
GTGACAAACCTGGGGAATGCGGTCTGGGGAATGAGCGGAATCACGGCCTCCTCGACTTCTACGATATCCCCGCGG
CCGCAGACGCAGTCCACCATGACCAGCAAGCCGTCGTCTTCGGCCGGCAGCAAGCCGCCGTCTTCGGCCGGCAGC
AAGCCGCCATCTTCAGCCGGCAACAAGCCGCCAACTCTACCGGGCTAG
Gene >Hirsu2|10828
ATGTCTGCCGATATCCTTCCCCGGCCTGTGACCGCAGTCACACGGGAGCAGGCCTGGAAGACAACAAGACCGTGG
CGGTACAGACCCAGCACACAACCACGAGTTCTGCCACTTAACGAGCCTACACTCGATGCACCGCGGTCCGGCTTT
CAAACACAGAGTGCGAGAGCGGCTACATCGGACGGCAGCAAGATTCAGGAGAAGACGTCTTTTTTCGACGACCGC
TCCGTTTCTCGAGACGGGAGCACCGGCCGCGATATCGAAAAGTCGGCGCCCTGCCGGGCCGCGCCAGCCGGCTGG
CCCGTCCAGCCGGCCCCCGTCGACGGCTCGAGAAAGCTGACGAGGACCGAGCTCCGCGTCCAGCGCGTCGTCTTC
ATCGCCTTCGTCCTGGCCGTCAACCTCGGGCTGGCCGCCGTCACCGTCTTCGGCAAGGTCGGGCTTGCGACGCTC
GTCATCATCCTGTTCTTCAAGACGCAGGACTGCCTCTGCGTCCTCGTCTCGGCCGTCTGCCTGGCCTGGACGACG
GTGGCGGGCCTGTTCCGCAAGCCGGAGCCCCTGTCCCGGCGCTGGATCCTGTCTCTCCTGCCGGCGTACAACGAG
AGCGAGGAGCAGATCCTCCGATCGATCCAGGGCCTGCGCAAGAACGTGCAGGAGCCGCACCGGCAGGTCGTCGCC
ATCGTGCTCGACGGCCAGCCCAAGGAGATCAAGCACGAGTTCTCGCACATCGTGGCCGACTTCGAGCGCCCGTAC
CACTCGCTCAAGCACAAGGTCGGCACGCTCAAGGTCACGGCCGGCTTCTTCGACGACCTGCCGGTCATCATGATC
GAAAAGGCGCAGAACAGCGGCAAGAAGGACAGCTTGGTCCTGACGCACGACCTCTTCAACCACCCGCGCAAGAAC
ATGCCGGCCTATAGCCGCTTCCTGCGCGAGGAGCTCTGGACCAACGTCCTGCCGCTGCTCACGGCCGGCACCGAC
TTCGGCGCCTTCGACATGGTCTTCTGCACCGACGCCGACTCCGTCATCCACGACGGCTGCATCATGAAGCTGACC
GACCGCCTGGCCCGTGACGGCAAGGCCATCGCCGCCTGCGGCCTCGTCCTCGTCGAGTTCGAGCCGGGCCACGAG
TGGTCCTTCTGGAACTTCTTCCAGCTGCTGCAGTACGCCTACGGCCAGTTCGTCCGCCGCTGGGCCGAGGGCTTC
GTCGGAAAGGTCACCTGCCTGCCGGGGTGCGTCACCATGATCGCCGTCCGCGAGGAGATGGCCGGCGCCATCGCC
AAGTTCGCCCGCCCGGTCAAGGAGGACTGGGTGCTCCATCACCAGGTCCAAAATCTGGGCACCGACCGCCGACTG
ACGTACTGCATGCTGAGCCAAGGGAAGAAGCTGCGTACTCTCTTCGTCCCGGACGCCCTCTCCGAGACGGTCGCC
CCCCAGTCCTTCAAGCACTACCTGCACCAGCGCCGTCGTTGGGGCTCCAACGCCTACTTCAACAACTTCTTCTAC
TTCGCCGGCGTCAAGATGATCCTCTTCACTCGTTTCATTGCCTTTCTCCACATCCTGCGCCAGACGTGCGTTTAC
TATCGTGTCCTCAACACCATTCTCTTCATCCGCTGCCTCGTTCTTCACTTCAACATCATGGACATCCTGCCACTC
TTGGTCGTCGGCCAGCTTCCGGGCCTGTGGTTCTGCATCTGTCTGCTGATCCAGCGCTCCCTGCGGGTCAGGATA
CACAAGATCATTGTCGGTTGGCTTCTGAATAAAATCGTCTCGCCAATCATGTCTTCCATCGTCTTCGCCGCCGTG
GTGACAAACCTGGGGAATGCGGTCTGGGGAATGAGCGGAATCACGGCCTCCTCGACTTCTACGATATCCCCGCGG
CCGCAGACGCAGTCCACCATGACCAGCAAGCCGTCGTCTTCGGCCGGCAGCAAGCCGCCGTCTTCGGCCGGCAGC
AAGCCGCCATCTTCAGCCGGCAACAAGCCGCCAACTCTACCGGGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail