Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10805
Gene name
LocationContig_906:163..2246
Strand-
Gene length (bp)2083
Transcript length (bp)1878
Coding sequence length (bp)1878
Protein length (aa) 626

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00264 Tyrosinase Common central domain of tyrosinase 2.9E-46 91 346
PF18132 Tyosinase_C Tyosinase C-terminal domain 2.5E-30 481 597

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92396|TYRO_PODAS Tyrosinase OS=Podospora anserina GN=TYR PE=2 SV=1 43 561 8.0E-85
sp|P00440|TYRO_NEUCR Tyrosinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=T PE=1 SV=5 49 425 2.0E-72
sp|A7BHQ9|TYRO_PHONA Tyrosinase OS=Pholiota nameko GN=tyr1 PE=1 SV=1 54 605 3.0E-70
sp|Q00024|PPO1_AGABI Polyphenol oxidase 1 OS=Agaricus bisporus GN=PPO1 PE=2 SV=1 54 581 5.0E-67
sp|O42713|PPO2_AGABI Polyphenol oxidase 2 OS=Agaricus bisporus GN=PPO2 PE=2 SV=1 54 434 4.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92396|TYRO_PODAS Tyrosinase OS=Podospora anserina GN=TYR PE=2 SV=1 43 561 8.0E-85
sp|P00440|TYRO_NEUCR Tyrosinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=T PE=1 SV=5 49 425 2.0E-72
sp|A7BHQ9|TYRO_PHONA Tyrosinase OS=Pholiota nameko GN=tyr1 PE=1 SV=1 54 605 3.0E-70
sp|Q00024|PPO1_AGABI Polyphenol oxidase 1 OS=Agaricus bisporus GN=PPO1 PE=2 SV=1 54 581 5.0E-67
sp|O42713|PPO2_AGABI Polyphenol oxidase 2 OS=Agaricus bisporus GN=PPO2 PE=2 SV=1 54 434 4.0E-55
sp|C7FF05|PPO4_AGABI Polyphenol oxidase 4 OS=Agaricus bisporus GN=PPO4 PE=2 SV=1 54 582 5.0E-55
sp|C7FF04|PPO3_AGABI Polyphenol oxidase 3 OS=Agaricus bisporus GN=PPO3 PE=1 SV=1 54 605 2.0E-49
sp|Q8J130|TYRO_ASPFU Tyrosinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tyr1 PE=3 SV=2 42 579 5.0E-42
sp|P00440|TYRO_NEUCR Tyrosinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=T PE=1 SV=5 474 607 4.0E-13
sp|O61363|HCYG_ENTDO Hemocyanin G-type, units Oda to Odg OS=Enteroctopus dofleini GN=ODHCY PE=1 SV=1 76 425 6.0E-13
sp|Q00234|TYRO_ASPOR Tyrosinase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=melO PE=1 SV=1 45 405 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10805
MQGTTAAALVLQLCCVALVRALGYDFGLDVSLLTRRQDAATPIVVGKLPLAADGSIPRRLEIRQMRADQYKWDLF
ILGLSMFMNADQQDPLSWYQIAGIHGVPFQPWNGVLPVPGANQSGFCTHNSVLFPLWHRPYMALFEQQMFKMANA
IAAMFSNATQRRLYQQAAADFRVPYWDWSRSAPAGETHLPDVFWNPVVVQGGPNGVQTIKNPLYSYQFHPLDTEA
FIWNPLKQWNETKRGPETSVSLSAPPSNNEKVNAALLSKLAEIQQRLYVLFSNYHDFNSFSNKAWAVSKGLSTLD
SIESVHDIIHLYGGSKGHLTYVPLSSFDPLFLLHHTMTDRLIAIWQILNPSAWITPMPAGETSFTAIKGTMQSSD
SPLTPFYASSNGTFWTSDGARSTEAFGYTYADTDPLLESGPELRQSLIQKIGDWYGPSSPVGLLAKVQASGAAPA
DAGEGHVGGGGSGSEAPPGAAKAATGGRYTEWVANVHVNVEALDGAFAVHFFLGEPPGEASGWDSAPNLAGSVGV
FAMNRTTGSQSKISGAVPLTSALMRKVAAGALADLAPAAVTPLLRESLQFRILGSDEQQVEPRLVEGLYVGISSS
DVRLPEKLDELPVWGPAVTRLEKWV*
Coding >Hirsu2|10805
ATGCAGGGCACCACGGCAGCCGCCCTTGTCCTGCAACTCTGCTGCGTCGCCCTCGTCCGCGCTCTCGGATACGAC
TTCGGCCTCGACGTCTCGCTGCTCACCCGCCGCCAGGATGCCGCCACCCCCATCGTCGTGGGCAAGCTGCCCCTG
GCCGCCGACGGCAGCATCCCCCGCCGCCTCGAGATCCGGCAGATGAGGGCGGACCAGTACAAGTGGGATCTGTTC
ATTCTCGGCCTGAGCATGTTCATGAACGCCGACCAGCAGGACCCCCTTTCTTGGTACCAGATCGCCGGCATACAC
GGCGTGCCCTTCCAGCCCTGGAACGGGGTCCTGCCGGTCCCAGGCGCCAACCAGTCGGGCTTCTGTACGCACAAC
TCGGTCCTGTTTCCCCTGTGGCACCGGCCCTACATGGCCCTGTTCGAGCAACAAATGTTCAAGATGGCCAATGCC
ATCGCCGCCATGTTTAGCAACGCGACCCAGCGCCGACTCTATCAGCAAGCGGCCGCCGACTTCCGCGTGCCCTAC
TGGGACTGGTCCCGGAGCGCGCCCGCCGGCGAGACGCACCTGCCGGACGTCTTTTGGAACCCCGTCGTCGTCCAG
GGCGGCCCCAACGGCGTGCAAACCATCAAGAACCCCCTGTACTCGTACCAGTTCCACCCCCTCGACACCGAGGCC
TTCATCTGGAATCCTCTCAAGCAGTGGAACGAGACGAAGCGAGGGCCCGAGACGAGCGTCAGCCTCTCGGCTCCT
CCCTCCAACAACGAAAAGGTGAACGCGGCGCTGCTGTCCAAGCTGGCGGAGATCCAGCAGCGCCTGTACGTCCTC
TTCTCCAACTACCACGACTTCAACTCGTTCAGCAACAAGGCGTGGGCCGTGTCCAAGGGGCTGTCGACGCTGGAC
TCGATCGAGTCGGTCCACGACATCATCCACCTCTACGGCGGGTCCAAGGGACACTTGACCTACGTCCCCCTCTCC
TCCTTCGACCCTCTTTTCCTGCTGCACCACACCATGACGGACCGGCTCATTGCGATATGGCAGATTCTCAACCCG
TCGGCCTGGATTACCCCCATGCCGGCGGGTGAGACAAGCTTCACCGCCATCAAAGGCACCATGCAGTCCTCGGAC
AGTCCGCTCACACCGTTCTACGCGTCGTCGAACGGCACGTTCTGGACATCGGACGGCGCGCGATCCACGGAGGCC
TTTGGCTACACGTACGCCGACACGGACCCGCTGCTCGAGTCTGGCCCAGAGCTCCGCCAGTCGCTCATCCAGAAG
ATCGGCGATTGGTACGGGCCCTCAAGCCCCGTGGGCCTGCTGGCCAAGGTGCAGGCCTCCGGAGCTGCTCCGGCC
GATGCAGGGGAGGGCCATGTCGGGGGGGGCGGATCTGGGTCCGAGGCCCCGCCGGGCGCAGCCAAGGCGGCGACT
GGCGGTCGCTACACGGAGTGGGTGGCCAACGTGCACGTCAACGTGGAGGCGCTCGACGGCGCCTTCGCCGTCCAC
TTTTTCCTGGGCGAGCCGCCGGGCGAGGCGAGCGGGTGGGATTCGGCGCCGAACCTGGCGGGATCGGTCGGCGTC
TTCGCCATGAACCGCACGACGGGGTCCCAGTCCAAGATTTCGGGCGCCGTGCCTCTGACCTCGGCCCTGATGAGA
AAGGTGGCGGCCGGGGCGCTCGCAGACTTGGCCCCGGCCGCCGTCACCCCGTTACTCAGGGAATCCTTGCAGTTC
CGGATACTTGGGAGCGACGAGCAACAAGTCGAGCCGAGGCTGGTCGAGGGGCTCTACGTCGGGATCAGCAGCTCG
GACGTCAGGCTTCCCGAGAAGCTGGACGAGCTGCCGGTCTGGGGCCCGGCGGTGACGAGGCTGGAGAAGTGGGTG
TGA
Transcript >Hirsu2|10805
ATGCAGGGCACCACGGCAGCCGCCCTTGTCCTGCAACTCTGCTGCGTCGCCCTCGTCCGCGCTCTCGGATACGAC
TTCGGCCTCGACGTCTCGCTGCTCACCCGCCGCCAGGATGCCGCCACCCCCATCGTCGTGGGCAAGCTGCCCCTG
GCCGCCGACGGCAGCATCCCCCGCCGCCTCGAGATCCGGCAGATGAGGGCGGACCAGTACAAGTGGGATCTGTTC
ATTCTCGGCCTGAGCATGTTCATGAACGCCGACCAGCAGGACCCCCTTTCTTGGTACCAGATCGCCGGCATACAC
GGCGTGCCCTTCCAGCCCTGGAACGGGGTCCTGCCGGTCCCAGGCGCCAACCAGTCGGGCTTCTGTACGCACAAC
TCGGTCCTGTTTCCCCTGTGGCACCGGCCCTACATGGCCCTGTTCGAGCAACAAATGTTCAAGATGGCCAATGCC
ATCGCCGCCATGTTTAGCAACGCGACCCAGCGCCGACTCTATCAGCAAGCGGCCGCCGACTTCCGCGTGCCCTAC
TGGGACTGGTCCCGGAGCGCGCCCGCCGGCGAGACGCACCTGCCGGACGTCTTTTGGAACCCCGTCGTCGTCCAG
GGCGGCCCCAACGGCGTGCAAACCATCAAGAACCCCCTGTACTCGTACCAGTTCCACCCCCTCGACACCGAGGCC
TTCATCTGGAATCCTCTCAAGCAGTGGAACGAGACGAAGCGAGGGCCCGAGACGAGCGTCAGCCTCTCGGCTCCT
CCCTCCAACAACGAAAAGGTGAACGCGGCGCTGCTGTCCAAGCTGGCGGAGATCCAGCAGCGCCTGTACGTCCTC
TTCTCCAACTACCACGACTTCAACTCGTTCAGCAACAAGGCGTGGGCCGTGTCCAAGGGGCTGTCGACGCTGGAC
TCGATCGAGTCGGTCCACGACATCATCCACCTCTACGGCGGGTCCAAGGGACACTTGACCTACGTCCCCCTCTCC
TCCTTCGACCCTCTTTTCCTGCTGCACCACACCATGACGGACCGGCTCATTGCGATATGGCAGATTCTCAACCCG
TCGGCCTGGATTACCCCCATGCCGGCGGGTGAGACAAGCTTCACCGCCATCAAAGGCACCATGCAGTCCTCGGAC
AGTCCGCTCACACCGTTCTACGCGTCGTCGAACGGCACGTTCTGGACATCGGACGGCGCGCGATCCACGGAGGCC
TTTGGCTACACGTACGCCGACACGGACCCGCTGCTCGAGTCTGGCCCAGAGCTCCGCCAGTCGCTCATCCAGAAG
ATCGGCGATTGGTACGGGCCCTCAAGCCCCGTGGGCCTGCTGGCCAAGGTGCAGGCCTCCGGAGCTGCTCCGGCC
GATGCAGGGGAGGGCCATGTCGGGGGGGGCGGATCTGGGTCCGAGGCCCCGCCGGGCGCAGCCAAGGCGGCGACT
GGCGGTCGCTACACGGAGTGGGTGGCCAACGTGCACGTCAACGTGGAGGCGCTCGACGGCGCCTTCGCCGTCCAC
TTTTTCCTGGGCGAGCCGCCGGGCGAGGCGAGCGGGTGGGATTCGGCGCCGAACCTGGCGGGATCGGTCGGCGTC
TTCGCCATGAACCGCACGACGGGGTCCCAGTCCAAGATTTCGGGCGCCGTGCCTCTGACCTCGGCCCTGATGAGA
AAGGTGGCGGCCGGGGCGCTCGCAGACTTGGCCCCGGCCGCCGTCACCCCGTTACTCAGGGAATCCTTGCAGTTC
CGGATACTTGGGAGCGACGAGCAACAAGTCGAGCCGAGGCTGGTCGAGGGGCTCTACGTCGGGATCAGCAGCTCG
GACGTCAGGCTTCCCGAGAAGCTGGACGAGCTGCCGGTCTGGGGCCCGGCGGTGACGAGGCTGGAGAAGTGGGTG
TGA
Gene >Hirsu2|10805
ATGCAGGGCACCACGGCAGCCGCCCTTGTCCTGCAACTCTGCTGCGTCGCCCTCGTCCGCGCTCTCGGATACGAC
TTCGGCCTCGACGTCTCGCTGCTCACCCGCCGCCAGGATGCCGCCACCCCCATCGTCGTGGGCAAGCTGCCCCTG
GCCGCCGACGGCAGCATCCCCCGCCGCCTCGAGATCCGGCAGATGAGGGCGGACCAGTACAAGTGGGATCTGTTC
ATTCTCGGCCTGAGCATGTTCATGAACGCCGACCAGCAGGACCCCCTTTCTTGGTACCAGATCGCCGGTGAGTCG
ATCCCCCAGCCCGGCAACGACTGCGAGGCTGACATGGGTCACAACCTCTGGCTCTCCGCTCCGCCGCCCAGGCAT
ACACGGCGTGCCCTTCCAGCCCTGGAACGGGGTCCTGCCGGTCCCAGGCGCCAACCAGTCGGGCTTCTGTACGCA
CAACTCGGTCCTGTTTCCCCTGTGGCACCGGCCCTACATGGCCCTGTTCGAGGTGAGTGGCGACGGTTGCTCCCC
GCCGGCGGCTACATTGCTCGGCTAAGCAGAGCTGCGGTGAAGCAACAAATGTTCAAGATGGCCAATGCCATCGCC
GCCATGTTTAGCAACGCGACCCAGCGCCGACTCTATCAGCAAGCGGCCGCCGACTTCCGCGTGCCCTACTGGGAC
TGGTCCCGGAGCGCGCCCGCCGGCGAGACGCACCTGCCGGACGTCTTTTGGAACCCCGTCGTCGTCCAGGGCGGC
CCCAACGGCGTGCAAACCATCAAGAACCCCCTGTACTCGTACCAGTTCCACCCCCTCGACACCGAGGCCTTCATC
TGGAATCCTGTAAGCACCATGCCATGCCGCCTGTCGCCTCCAGCCTCGCCGCTGACGACCGGCAACAAAGCTCAA
GCAGTGGAACGAGACGAAGCGAGGGCCCGAGACGAGCGTCAGCCTCTCGGCTCCTCCCTCCAACAACGAAAAGGT
GAACGCGGCGCTGCTGTCCAAGCTGGCGGAGATCCAGCAGCGCCTGTACGTCCTCTTCTCCAACTACCACGACTT
CAACTCGTTCAGCAACAAGGCGTGGGCCGTGTCCAAGGGGCTGTCGACGCTGGACTCGATCGAGTCGGTCCACGA
CATCATCCACCTCTACGGCGGGTCCAAGGGACACTTGACCTACGTCCCCCTCTCCTCCTTCGACCCTCTTTTCCT
GCTGCACCACACCATGACGGACCGGCTCATTGCGATATGGCAGATTCTCAACCCGTCGGCCTGGATTACCCCCAT
GCCGGCGGGTGAGACAAGCTTCACCGCCATCAAAGGCACCATGCAGTCCTCGGACAGTCCGCTCACACCGTTCTA
CGCGTCGTCGAACGGCACGTTCTGGACATCGGACGGCGCGCGATCCACGGAGGCCTTTGGCTACACGTACGCCGA
CACGGACCCGCTGCTCGAGTCTGGCCCAGAGCTCCGCCAGTCGCTCATCCAGAAGATCGGCGATTGGTACGGGCC
CTCAAGCCCCGTGGGCCTGCTGGCCAAGGTGCAGGCCTCCGGAGCTGCTCCGGCCGATGCAGGGGAGGGCCATGT
CGGGGGGGGCGGATCTGGGTCCGAGGCCCCGCCGGGCGCAGCCAAGGCGGCGACTGGCGGTCGCTACACGGAGTG
GGTGGCCAACGTGCACGTCAACGTGGAGGCGCTCGACGGCGCCTTCGCCGTCCACTTTTTCCTGGGCGAGCCGCC
GGGCGAGGCGAGCGGGTGGGATTCGGCGCCGAACCTGGCGGGATCGGTCGGCGTCTTCGCCATGAACCGCACGAC
GGGGTCCCAGTCCAAGATTTCGGGCGCCGTGCCTCTGACCTCGGCCCTGATGAGAAAGGTGGCGGCCGGGGCGCT
CGCAGACTTGGCCCCGGCCGCCGTCACCCCGTTACTCAGGGAATCCTTGCAGTTCCGGATACTTGGGAGCGACGA
GCAACAAGTCGAGCCGAGGCTGGTCGAGGGGCTCTACGTCGGGATCAGCAGCTCGGACGTCAGGCTTCCCGAGAA
GCTGGACGAGCTGCCGGTCTGGGGCCCGGCGGTGACGAGGCTGGAGAAGTGGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail