Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1080
Gene name
LocationContig_1223:3120..7474
Strand-
Gene length (bp)4354
Transcript length (bp)4281
Coding sequence length (bp)4281
Protein length (aa) 1427

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01369 Sec7 Sec7 domain 1.1E-32 432 592

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13817|SEC7C_SCHPO Protein transport protein sec73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec73 PE=3 SV=2 438 996 6.0E-78
sp|Q10491|SEC74_SCHPO Arf guanine nucleotide exchange factor sec74 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec74 PE=1 SV=2 426 993 5.0E-71
sp|Q06836|SYT1_YEAST Arf guanine nucleotide exchange factor SYT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYT1 PE=1 SV=1 464 589 2.0E-22
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 430 588 8.0E-19
sp|Q9LZX8|BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana GN=BIG2 PE=2 SV=1 446 573 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13817|SEC7C_SCHPO Protein transport protein sec73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec73 PE=3 SV=2 438 996 6.0E-78
sp|Q10491|SEC74_SCHPO Arf guanine nucleotide exchange factor sec74 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec74 PE=1 SV=2 426 993 5.0E-71
sp|Q06836|SYT1_YEAST Arf guanine nucleotide exchange factor SYT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYT1 PE=1 SV=1 464 589 2.0E-22
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 430 588 8.0E-19
sp|Q9LZX8|BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana GN=BIG2 PE=2 SV=1 446 573 3.0E-18
sp|Q9LPC5|BIG3_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Arabidopsis thaliana GN=BIG3 PE=1 SV=1 446 613 2.0E-17
sp|P97696|CYH3_RAT Cytohesin-3 OS=Rattus norvegicus GN=Cyth3 PE=2 SV=1 446 599 1.0E-16
sp|O08967|CYH3_MOUSE Cytohesin-3 OS=Mus musculus GN=Cyth3 PE=1 SV=1 446 599 1.0E-16
sp|O43739|CYH3_HUMAN Cytohesin-3 OS=Homo sapiens GN=CYTH3 PE=1 SV=2 446 599 2.0E-16
sp|Q8NDX1|PSD4_HUMAN PH and SEC7 domain-containing protein 4 OS=Homo sapiens GN=PSD4 PE=1 SV=2 449 636 3.0E-16
sp|Q9Y6D5|BIG2_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens GN=ARFGEF2 PE=1 SV=3 316 588 5.0E-16
sp|P97694|CYH1_RAT Cytohesin-1 OS=Rattus norvegicus GN=Cyth1 PE=1 SV=1 446 599 8.0E-16
sp|Q9QX11|CYH1_MOUSE Cytohesin-1 OS=Mus musculus GN=Cyth1 PE=1 SV=2 446 599 8.0E-16
sp|A2A5R2|BIG2_MOUSE Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Mus musculus GN=Arfgef2 PE=1 SV=1 316 588 9.0E-16
sp|Q99418|CYH2_HUMAN Cytohesin-2 OS=Homo sapiens GN=CYTH2 PE=1 SV=2 446 599 1.0E-15
sp|Q5DTT2|PSD1_MOUSE PH and SEC7 domain-containing protein 1 OS=Mus musculus GN=Psd PE=1 SV=2 449 588 1.0E-15
sp|A5PKW4|PSD1_HUMAN PH and SEC7 domain-containing protein 1 OS=Homo sapiens GN=PSD PE=1 SV=2 449 588 1.0E-15
sp|Q76MY7|CYH2_CHLAE Cytohesin-2 OS=Chlorocebus aethiops GN=CYTH2 PE=2 SV=1 446 599 1.0E-15
sp|P11075|SEC7_YEAST Protein transport protein SEC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC7 PE=1 SV=2 443 580 2.0E-15
sp|Q9P7V5|SEC7B_SCHPO Protein transport protein sec72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec72 PE=1 SV=1 444 610 2.0E-15
sp|F4JN05|BIG4_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 4 OS=Arabidopsis thaliana GN=BIG4 PE=3 SV=1 446 588 2.0E-15
sp|Q15438|CYH1_HUMAN Cytohesin-1 OS=Homo sapiens GN=CYTH1 PE=1 SV=1 446 599 2.0E-15
sp|Q76MZ1|CYH1_CHLAE Cytohesin-1 OS=Chlorocebus aethiops GN=CYTH1 PE=2 SV=1 446 599 2.0E-15
sp|F4JSZ5|BIG1_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Arabidopsis thaliana GN=BIG1 PE=2 SV=1 459 588 2.0E-15
sp|Q2KI41|CYH2_BOVIN Cytohesin-2 OS=Bos taurus GN=CYTH2 PE=2 SV=1 446 599 2.0E-15
sp|Q7TSU1|BIG2_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Rattus norvegicus GN=Arfgef2 PE=1 SV=1 316 588 4.0E-15
sp|Q9ESQ7|PSD1_RAT PH and SEC7 domain-containing protein 1 OS=Rattus norvegicus GN=Psd PE=1 SV=1 449 588 6.0E-15
sp|P63035|CYH2_RAT Cytohesin-2 OS=Rattus norvegicus GN=Cyth2 PE=1 SV=1 446 599 7.0E-15
sp|P63034|CYH2_MOUSE Cytohesin-2 OS=Mus musculus GN=Cyth2 PE=1 SV=2 446 599 7.0E-15
sp|D4A631|BIG1_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Rattus norvegicus GN=Arfgef1 PE=1 SV=1 446 589 7.0E-15
sp|Q9UT02|SEC7A_SCHPO Protein transport protein sec71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec71 PE=1 SV=1 449 573 1.0E-14
sp|F1MUS9|PSD1_BOVIN PH and SEC7 domain-containing protein 1 OS=Bos taurus GN=PSD PE=2 SV=1 449 588 1.0E-14
sp|O46382|BIG1_BOVIN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Bos taurus GN=ARFGEF1 PE=1 SV=1 446 589 1.0E-14
sp|Q9Y6D6|BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens GN=ARFGEF1 PE=1 SV=2 446 589 2.0E-14
sp|G3X9K3|BIG1_MOUSE Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Mus musculus GN=Arfgef1 PE=1 SV=1 446 589 2.0E-14
sp|Q80YW0|CYH4_MOUSE Cytohesin-4 OS=Mus musculus GN=Cyth4 PE=1 SV=1 444 599 3.0E-14
sp|Q8BLR5|PSD4_MOUSE PH and SEC7 domain-containing protein 4 OS=Mus musculus GN=Psd4 PE=1 SV=1 444 636 4.0E-14
sp|Q9FLY5|GNL1_ARATH ARF guanine-nucleotide exchange factor GNL1 OS=Arabidopsis thaliana GN=GNL1 PE=3 SV=1 430 572 9.0E-14
sp|Q9UIA0|CYH4_HUMAN Cytohesin-4 OS=Homo sapiens GN=CYTH4 PE=2 SV=1 444 599 1.0E-13
sp|Q42510|GNOM_ARATH ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana GN=GN PE=1 SV=1 427 572 4.0E-13
sp|Q6DN90|IQEC1_HUMAN IQ motif and SEC7 domain-containing protein 1 OS=Homo sapiens GN=IQSEC1 PE=1 SV=1 433 604 2.0E-12
sp|F4IXW2|BIG5_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 5 OS=Arabidopsis thaliana GN=BIG5 PE=1 SV=2 475 618 3.0E-12
sp|Q8R0S2|IQEC1_MOUSE IQ motif and SEC7 domain-containing protein 1 OS=Mus musculus GN=Iqsec1 PE=1 SV=2 459 604 4.0E-12
sp|Q2PFD7|PSD3_MOUSE PH and SEC7 domain-containing protein 3 OS=Mus musculus GN=Psd3 PE=1 SV=2 412 588 6.0E-12
sp|Q9P7R8|YHV3_SCHPO Uncharacterized protein C211.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC211.03c PE=1 SV=1 459 573 8.0E-12
sp|Q9NYI0|PSD3_HUMAN PH and SEC7 domain-containing protein 3 OS=Homo sapiens GN=PSD3 PE=1 SV=2 449 588 1.0E-11
sp|Q9UPP2|IQEC3_HUMAN IQ motif and SEC7 domain-containing protein 3 OS=Homo sapiens GN=IQSEC3 PE=2 SV=3 459 600 6.0E-11
sp|Q3TES0|IQEC3_MOUSE IQ motif and SEC7 domain-containing protein 3 OS=Mus musculus GN=Iqsec3 PE=1 SV=1 459 600 6.0E-11
sp|Q76M68|IQEC3_RAT IQ motif and SEC7 domain-containing protein 3 OS=Rattus norvegicus GN=Iqsec3 PE=1 SV=1 459 600 7.0E-11
sp|Q6P1I6|PSD2_MOUSE PH and SEC7 domain-containing protein 2 OS=Mus musculus GN=Psd2 PE=1 SV=1 418 626 3.0E-10
sp|Q92538|GBF1_HUMAN Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens GN=GBF1 PE=1 SV=2 430 610 3.0E-10
sp|Q5JU85|IQEC2_HUMAN IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens GN=IQSEC2 PE=1 SV=1 459 588 3.0E-10
sp|Q5DU25|IQEC2_MOUSE IQ motif and SEC7 domain-containing protein 2 OS=Mus musculus GN=Iqsec2 PE=1 SV=3 459 588 4.0E-10
sp|Q9BQI7|PSD2_HUMAN PH and SEC7 domain-containing protein 2 OS=Homo sapiens GN=PSD2 PE=2 SV=3 418 588 4.0E-10
sp|F4K2K3|GNL2_ARATH ARF guanine-nucleotide exchange factor GNL2 OS=Arabidopsis thaliana GN=GNL2 PE=2 SV=1 473 573 5.0E-10
sp|Q9R1D7|GBF1_CRIGR Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Cricetulus griseus GN=GBF1 PE=1 SV=1 430 608 3.0E-09
sp|P39993|GEA2_YEAST ARF guanine-nucleotide exchange factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEA2 PE=1 SV=1 445 573 4.0E-08
sp|P34512|GRP1_CAEEL GTP exchange factor for ARFs 1 OS=Caenorhabditis elegans GN=grp-1 PE=3 SV=2 475 603 1.0E-06
sp|O13690|YDYB_SCHPO PH and SEC7 domain-containing protein C11E3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11E3.11c PE=3 SV=1 475 571 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005086 ARF guanyl-nucleotide exchange factor activity Yes
GO:0032012 regulation of ARF protein signal transduction Yes
GO:0098772 molecular function regulator No
GO:0048583 regulation of response to stimulus No
GO:0005488 binding No
GO:0009966 regulation of signal transduction No
GO:0051020 GTPase binding No
GO:1902531 regulation of intracellular signal transduction No
GO:0003674 molecular_function No
GO:0010646 regulation of cell communication No
GO:0019899 enzyme binding No
GO:0023051 regulation of signaling No
GO:0046578 regulation of Ras protein signal transduction No
GO:0065007 biological regulation No
GO:0005085 guanyl-nucleotide exchange factor activity No
GO:0051056 regulation of small GTPase mediated signal transduction No
GO:0008150 biological_process No
GO:0005515 protein binding No
GO:0050789 regulation of biological process No
GO:0050794 regulation of cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1080
MPSLRRRGKVVSETDMRRHTSPATTAFDNNPNTSGPSSKTGQEINHIKRQPQPKPSLPSVQQQDYGKRHEQLQLY
PSLSETVWPEPSNRDSEPAAPTSDASPADAKLGSNRHRRFSVLRFRNASDSQLSLRAKQQAEKPPPVPTPPSIIT
TAPTSDASGPRKMTSRMSLAAKFRRSTEVQRKDAAGAKTQGLLPKPPTERRSRPSLTTSAHPPPPSWLMSGSDGA
TLGVSNNRRSESSKSDASSADRSTHPNPPFIEKKAQIPTSFFKLGRARKSPESMFPLAHLPQKNAAPSASGSALS
LRADQTPRPSSAQSASTSRACADQCDHGSAISAANTATRLCRGNAPHSNHSSPTRSNLLRGRSSTMSSIGLESAD
DHLLPPTTRTSTSTGRKSFGDLLGLSRIRQTSDLSRQGSSTPVTPGSITSKRNSFQLQRGVISLPERLDDESPAK
FLARLEDLLNRGTLASALSKGTDLFSAAVLRSYMRRFSFFGDPMDMALRKLLMEAELPKETQQIDRCLQAFANRY
HECNPGIYSSSEQAYFIAFSLLILHTDVFNKNNKHKMQKSDYLKNTRGEGIFDEILECFYDNISYTPFIHVEDDV
DVSQDRPVTNKSKKRQRPSSRVSDSAKRAAKEPVDPYTIILDGNLDALRPNWKDAMHLDDNYNYLGSAAGLNLRD
LQKTFFRTAVLQIVSARSRPDAFMTERTASNPEDAHPGIVDIKITKVGLLWRKDTKKRKTRSPWQEWGAILTGAQ
LYFFRNTSWVKSLMQQYENHIKAGHDGIPIIFKPPLEEFKPDALMSTQGAVALLDATYKKHKNAFVYVRQGVVDE
VLLADNEDERNDWLAKLNYAAAFRTSGVRMRGVVGGNYDGQGRRGIRRLDTSDATQLVQTPTGPVSIVRGRIDHK
MAQDIQAARRVGIQRKIAEADRKVEDAQRQLEEQLRNARHLQILAPIQPRTRDLLLLAAARMAAQLKWTRMVIWK
ERCHRDILKQDLADDRPLSASTVTPTRSQPELDLLSPPTPRPLATNLESEPSQRASVDVNAQISTQISTNSDSIC
ICSEVDAPRDRESTDIESSQTPSQSATRFRQGSNSPSYIEGTTQEPVLCSNSSLLPSPTAPPHLRPISPKERRNI
AIPSGSSRSLDEVDADERDFLKQTGLWEAEPGRGSIDKITMSTSAESADHGSLADRDRSERMKARRSLQRTLRES
AGHLSHHRGRKGKEAVHGGGLDDGPLDTTLTRGTGSFVVHGKKASVIKLGTELQSMSQDEIFVRKQLQQQQQSEQ
PVTSPRQGGVLDDDIHSAPEPPSDLREKDDRRESSTSAGTATARSFRELHRRYSSAQAARSVSAGGRLAIPSDGE
SEAAVSLTEGGKSPRPTGPDAEDVKGKKKASSRQTPLQESTRNGESTDDGSCSTGDKALLETNQLSGQPVQAIVN
A*
Coding >Hirsu2|1080
ATGCCATCACTCCGTCGTCGAGGAAAAGTGGTCAGTGAGACAGATATGCGACGGCATACTTCTCCGGCGACAACA
GCATTTGACAACAACCCCAATACCAGCGGCCCTTCAAGTAAGACTGGACAGGAAATCAATCATATCAAACGCCAG
CCACAGCCCAAACCGTCCTTGCCTTCGGTACAGCAACAGGACTATGGCAAGCGACATGAACAATTGCAATTGTAC
CCCTCTCTCTCAGAGACTGTCTGGCCAGAGCCATCGAACCGCGACTCCGAACCTGCCGCCCCCACTTCAGATGCC
TCTCCTGCCGATGCCAAACTCGGCTCCAACAGGCATCGGCGCTTTTCGGTGTTACGTTTTCGCAATGCATCCGAC
TCGCAACTCTCCCTCAGGGCTAAACAGCAAGCTGAGAAACCACCCCCCGTTCCAACGCCCCCTTCCATCATCACT
ACAGCCCCGACGAGCGATGCATCCGGGCCCAGAAAAATGACGTCTCGTATGAGCCTCGCTGCAAAATTCCGCCGG
TCTACCGAGGTTCAGCGAAAGGATGCTGCAGGTGCCAAGACCCAGGGACTCCTCCCAAAGCCGCCGACTGAAAGA
AGGAGCCGGCCATCTCTTACGACATCCGCTCATCCTCCTCCACCGTCCTGGCTAATGTCCGGCTCGGATGGCGCC
ACTCTGGGAGTGTCGAATAACCGTCGATCCGAATCATCCAAATCTGACGCAAGCTCCGCAGATCGCTCTACCCAC
CCAAACCCACCATTCATTGAGAAGAAGGCTCAAATTCCAACCTCATTTTTCAAGCTGGGCAGGGCGAGGAAGTCT
CCCGAGAGCATGTTCCCCCTGGCACACCTCCCGCAAAAAAATGCCGCTCCGTCTGCGAGCGGATCTGCATTATCT
CTCCGTGCGGATCAGACGCCACGCCCTAGCTCGGCCCAGAGTGCATCGACCTCACGTGCCTGTGCTGATCAGTGC
GACCACGGCTCAGCTATCTCAGCCGCTAATACTGCCACTCGGCTGTGTCGTGGCAACGCTCCTCATTCAAATCAC
TCGTCACCCACTCGATCCAACCTGCTCAGAGGTCGATCTTCGACGATGAGCTCTATAGGTCTCGAGTCAGCCGAC
GACCATCTCTTACCACCTACGACTCGGACATCAACCTCAACAGGCCGGAAGAGTTTTGGCGATTTGCTGGGGCTA
AGCCGCATACGCCAAACCTCCGATCTTAGCAGGCAGGGTTCATCGACGCCCGTCACCCCCGGGTCTATCACCTCC
AAACGCAACTCCTTCCAGCTCCAGAGAGGGGTCATTTCACTACCAGAACGACTTGATGACGAATCCCCGGCCAAG
TTCCTTGCGCGACTCGAGGACCTTCTCAATCGTGGTACACTTGCATCCGCTCTGTCCAAGGGAACCGATTTGTTC
TCGGCCGCCGTACTGAGAAGCTACATGCGACGCTTCAGTTTCTTCGGCGACCCAATGGATATGGCTCTAAGAAAA
CTTCTGATGGAGGCTGAGTTGCCGAAAGAAACGCAGCAGATTGATAGGTGCCTTCAGGCGTTTGCCAACCGGTAT
CACGAGTGCAATCCTGGCATTTATTCATCTTCAGAACAAGCCTATTTCATAGCTTTCTCACTCTTGATTCTCCAC
ACAGACGTTTTCAATAAAAACAACAAACACAAGATGCAAAAGTCGGACTATTTGAAGAATACTCGTGGAGAGGGC
ATTTTTGATGAGATACTCGAATGCTTTTATGACAATATCTCTTACACGCCATTCATTCATGTTGAGGACGATGTA
GACGTCAGCCAGGATCGGCCTGTGACTAACAAATCGAAGAAGAGGCAGCGCCCCTCTTCAAGGGTCAGCGATTCT
GCCAAACGTGCCGCCAAGGAACCTGTTGACCCATACACAATCATATTGGACGGCAACCTTGATGCTCTTCGGCCC
AACTGGAAGGACGCCATGCACCTGGATGATAATTACAACTACTTGGGTAGTGCCGCAGGTCTGAACTTAAGAGAC
TTGCAAAAGACGTTCTTTAGAACTGCGGTGCTTCAGATCGTTTCGGCCAGGTCTCGCCCCGATGCGTTTATGACA
GAGAGGACGGCCTCCAATCCCGAGGACGCTCATCCAGGCATTGTGGATATCAAAATTACCAAGGTTGGTCTGCTG
TGGCGAAAAGATACCAAGAAAAGGAAGACACGATCTCCGTGGCAAGAATGGGGGGCCATCCTCACAGGGGCCCAA
CTATACTTCTTTAGGAACACCAGTTGGGTGAAGAGCCTGATGCAGCAGTACGAAAATCATATTAAAGCCGGGCAT
GACGGGATCCCAATCATTTTCAAGCCCCCTTTAGAGGAATTCAAACCAGACGCGTTGATGTCGACGCAGGGCGCC
GTAGCTCTTCTGGACGCGACGTACAAAAAGCACAAGAACGCCTTTGTCTATGTGCGGCAGGGTGTCGTGGACGAA
GTCCTACTTGCGGATAACGAGGATGAGAGAAATGACTGGCTCGCCAAATTGAACTACGCGGCTGCGTTTCGGACG
TCCGGGGTGAGGATGCGAGGCGTTGTCGGGGGCAACTACGATGGCCAGGGTCGTCGTGGAATTAGGCGCCTTGAT
ACCTCTGACGCGACGCAACTTGTCCAAACGCCAACCGGGCCGGTTTCGATAGTGCGTGGCCGGATCGATCACAAA
ATGGCGCAAGATATCCAAGCAGCCCGGCGAGTTGGCATACAGCGTAAAATTGCAGAAGCAGACCGCAAGGTCGAG
GACGCCCAGAGACAACTCGAGGAACAGCTCCGAAATGCCCGTCATCTCCAGATTTTGGCCCCAATTCAACCCAGG
ACGCGGGACTTGCTGCTACTTGCCGCAGCTCGCATGGCCGCGCAGCTCAAATGGACTCGCATGGTCATCTGGAAA
GAAAGGTGTCATCGCGACATCCTTAAACAAGACCTTGCAGACGATAGGCCCTTGTCAGCATCAACGGTCACACCT
ACCAGAAGTCAACCAGAACTCGATCTGCTGTCGCCACCCACACCAAGACCACTGGCCACGAACCTTGAGTCCGAA
CCTAGTCAGCGTGCCTCAGTTGATGTCAACGCGCAAATATCCACGCAAATATCCACGAATTCGGATAGTATTTGC
ATCTGCAGCGAGGTCGATGCGCCTCGCGATAGAGAGTCAACTGATATCGAAAGTTCCCAGACACCGTCTCAGAGC
GCCACCAGGTTTCGTCAGGGATCGAACTCGCCATCCTATATAGAAGGTACAACGCAAGAACCAGTTTTGTGCTCA
AATTCTTCCCTTCTGCCGTCTCCCACGGCACCGCCTCATTTGCGACCAATCTCCCCTAAGGAGAGGAGAAACATA
GCAATCCCAAGCGGCTCAAGTCGCAGCCTCGACGAAGTCGATGCCGACGAACGCGACTTCTTGAAGCAAACAGGG
CTGTGGGAAGCTGAGCCCGGCAGAGGGTCAATCGACAAGATAACTATGTCGACGTCTGCGGAGAGCGCAGACCAT
GGCTCACTCGCTGATCGCGATAGATCGGAAAGGATGAAGGCACGACGGAGTTTGCAGCGCACCTTGAGAGAAAGT
GCTGGCCATTTGTCACACCACAGGGGCAGGAAGGGCAAAGAGGCCGTTCACGGTGGAGGGCTTGATGATGGACCG
CTCGATACCACACTCACACGTGGCACAGGAAGCTTCGTTGTTCATGGCAAGAAAGCGTCAGTCATAAAACTGGGC
ACAGAGCTTCAAAGCATGTCTCAAGATGAGATCTTTGTTCGCAAGCAGCTGCAGCAGCAGCAGCAAAGTGAACAG
CCAGTCACATCTCCTCGGCAGGGCGGAGTCCTTGATGATGACATTCATTCAGCGCCCGAGCCGCCATCAGACTTG
CGTGAAAAGGACGATCGTAGGGAGTCATCTACAAGTGCCGGCACCGCTACAGCTCGTAGCTTCCGAGAACTTCAC
AGAAGATACTCCTCGGCTCAAGCGGCTAGAAGCGTGTCAGCTGGCGGAAGACTCGCTATTCCCTCCGATGGCGAA
AGCGAAGCTGCTGTCAGCCTGACTGAAGGAGGCAAATCACCTCGCCCCACCGGGCCTGATGCAGAGGATGTTAAG
GGCAAAAAAAAAGCCTCTTCTCGACAAACGCCTCTACAGGAGTCAACGCGCAACGGTGAGTCGACAGACGATGGA
AGCTGCAGCACAGGCGACAAAGCTTTACTGGAGACGAACCAGCTTTCTGGCCAACCAGTTCAAGCCATCGTGAAC
GCCTGA
Transcript >Hirsu2|1080
ATGCCATCACTCCGTCGTCGAGGAAAAGTGGTCAGTGAGACAGATATGCGACGGCATACTTCTCCGGCGACAACA
GCATTTGACAACAACCCCAATACCAGCGGCCCTTCAAGTAAGACTGGACAGGAAATCAATCATATCAAACGCCAG
CCACAGCCCAAACCGTCCTTGCCTTCGGTACAGCAACAGGACTATGGCAAGCGACATGAACAATTGCAATTGTAC
CCCTCTCTCTCAGAGACTGTCTGGCCAGAGCCATCGAACCGCGACTCCGAACCTGCCGCCCCCACTTCAGATGCC
TCTCCTGCCGATGCCAAACTCGGCTCCAACAGGCATCGGCGCTTTTCGGTGTTACGTTTTCGCAATGCATCCGAC
TCGCAACTCTCCCTCAGGGCTAAACAGCAAGCTGAGAAACCACCCCCCGTTCCAACGCCCCCTTCCATCATCACT
ACAGCCCCGACGAGCGATGCATCCGGGCCCAGAAAAATGACGTCTCGTATGAGCCTCGCTGCAAAATTCCGCCGG
TCTACCGAGGTTCAGCGAAAGGATGCTGCAGGTGCCAAGACCCAGGGACTCCTCCCAAAGCCGCCGACTGAAAGA
AGGAGCCGGCCATCTCTTACGACATCCGCTCATCCTCCTCCACCGTCCTGGCTAATGTCCGGCTCGGATGGCGCC
ACTCTGGGAGTGTCGAATAACCGTCGATCCGAATCATCCAAATCTGACGCAAGCTCCGCAGATCGCTCTACCCAC
CCAAACCCACCATTCATTGAGAAGAAGGCTCAAATTCCAACCTCATTTTTCAAGCTGGGCAGGGCGAGGAAGTCT
CCCGAGAGCATGTTCCCCCTGGCACACCTCCCGCAAAAAAATGCCGCTCCGTCTGCGAGCGGATCTGCATTATCT
CTCCGTGCGGATCAGACGCCACGCCCTAGCTCGGCCCAGAGTGCATCGACCTCACGTGCCTGTGCTGATCAGTGC
GACCACGGCTCAGCTATCTCAGCCGCTAATACTGCCACTCGGCTGTGTCGTGGCAACGCTCCTCATTCAAATCAC
TCGTCACCCACTCGATCCAACCTGCTCAGAGGTCGATCTTCGACGATGAGCTCTATAGGTCTCGAGTCAGCCGAC
GACCATCTCTTACCACCTACGACTCGGACATCAACCTCAACAGGCCGGAAGAGTTTTGGCGATTTGCTGGGGCTA
AGCCGCATACGCCAAACCTCCGATCTTAGCAGGCAGGGTTCATCGACGCCCGTCACCCCCGGGTCTATCACCTCC
AAACGCAACTCCTTCCAGCTCCAGAGAGGGGTCATTTCACTACCAGAACGACTTGATGACGAATCCCCGGCCAAG
TTCCTTGCGCGACTCGAGGACCTTCTCAATCGTGGTACACTTGCATCCGCTCTGTCCAAGGGAACCGATTTGTTC
TCGGCCGCCGTACTGAGAAGCTACATGCGACGCTTCAGTTTCTTCGGCGACCCAATGGATATGGCTCTAAGAAAA
CTTCTGATGGAGGCTGAGTTGCCGAAAGAAACGCAGCAGATTGATAGGTGCCTTCAGGCGTTTGCCAACCGGTAT
CACGAGTGCAATCCTGGCATTTATTCATCTTCAGAACAAGCCTATTTCATAGCTTTCTCACTCTTGATTCTCCAC
ACAGACGTTTTCAATAAAAACAACAAACACAAGATGCAAAAGTCGGACTATTTGAAGAATACTCGTGGAGAGGGC
ATTTTTGATGAGATACTCGAATGCTTTTATGACAATATCTCTTACACGCCATTCATTCATGTTGAGGACGATGTA
GACGTCAGCCAGGATCGGCCTGTGACTAACAAATCGAAGAAGAGGCAGCGCCCCTCTTCAAGGGTCAGCGATTCT
GCCAAACGTGCCGCCAAGGAACCTGTTGACCCATACACAATCATATTGGACGGCAACCTTGATGCTCTTCGGCCC
AACTGGAAGGACGCCATGCACCTGGATGATAATTACAACTACTTGGGTAGTGCCGCAGGTCTGAACTTAAGAGAC
TTGCAAAAGACGTTCTTTAGAACTGCGGTGCTTCAGATCGTTTCGGCCAGGTCTCGCCCCGATGCGTTTATGACA
GAGAGGACGGCCTCCAATCCCGAGGACGCTCATCCAGGCATTGTGGATATCAAAATTACCAAGGTTGGTCTGCTG
TGGCGAAAAGATACCAAGAAAAGGAAGACACGATCTCCGTGGCAAGAATGGGGGGCCATCCTCACAGGGGCCCAA
CTATACTTCTTTAGGAACACCAGTTGGGTGAAGAGCCTGATGCAGCAGTACGAAAATCATATTAAAGCCGGGCAT
GACGGGATCCCAATCATTTTCAAGCCCCCTTTAGAGGAATTCAAACCAGACGCGTTGATGTCGACGCAGGGCGCC
GTAGCTCTTCTGGACGCGACGTACAAAAAGCACAAGAACGCCTTTGTCTATGTGCGGCAGGGTGTCGTGGACGAA
GTCCTACTTGCGGATAACGAGGATGAGAGAAATGACTGGCTCGCCAAATTGAACTACGCGGCTGCGTTTCGGACG
TCCGGGGTGAGGATGCGAGGCGTTGTCGGGGGCAACTACGATGGCCAGGGTCGTCGTGGAATTAGGCGCCTTGAT
ACCTCTGACGCGACGCAACTTGTCCAAACGCCAACCGGGCCGGTTTCGATAGTGCGTGGCCGGATCGATCACAAA
ATGGCGCAAGATATCCAAGCAGCCCGGCGAGTTGGCATACAGCGTAAAATTGCAGAAGCAGACCGCAAGGTCGAG
GACGCCCAGAGACAACTCGAGGAACAGCTCCGAAATGCCCGTCATCTCCAGATTTTGGCCCCAATTCAACCCAGG
ACGCGGGACTTGCTGCTACTTGCCGCAGCTCGCATGGCCGCGCAGCTCAAATGGACTCGCATGGTCATCTGGAAA
GAAAGGTGTCATCGCGACATCCTTAAACAAGACCTTGCAGACGATAGGCCCTTGTCAGCATCAACGGTCACACCT
ACCAGAAGTCAACCAGAACTCGATCTGCTGTCGCCACCCACACCAAGACCACTGGCCACGAACCTTGAGTCCGAA
CCTAGTCAGCGTGCCTCAGTTGATGTCAACGCGCAAATATCCACGCAAATATCCACGAATTCGGATAGTATTTGC
ATCTGCAGCGAGGTCGATGCGCCTCGCGATAGAGAGTCAACTGATATCGAAAGTTCCCAGACACCGTCTCAGAGC
GCCACCAGGTTTCGTCAGGGATCGAACTCGCCATCCTATATAGAAGGTACAACGCAAGAACCAGTTTTGTGCTCA
AATTCTTCCCTTCTGCCGTCTCCCACGGCACCGCCTCATTTGCGACCAATCTCCCCTAAGGAGAGGAGAAACATA
GCAATCCCAAGCGGCTCAAGTCGCAGCCTCGACGAAGTCGATGCCGACGAACGCGACTTCTTGAAGCAAACAGGG
CTGTGGGAAGCTGAGCCCGGCAGAGGGTCAATCGACAAGATAACTATGTCGACGTCTGCGGAGAGCGCAGACCAT
GGCTCACTCGCTGATCGCGATAGATCGGAAAGGATGAAGGCACGACGGAGTTTGCAGCGCACCTTGAGAGAAAGT
GCTGGCCATTTGTCACACCACAGGGGCAGGAAGGGCAAAGAGGCCGTTCACGGTGGAGGGCTTGATGATGGACCG
CTCGATACCACACTCACACGTGGCACAGGAAGCTTCGTTGTTCATGGCAAGAAAGCGTCAGTCATAAAACTGGGC
ACAGAGCTTCAAAGCATGTCTCAAGATGAGATCTTTGTTCGCAAGCAGCTGCAGCAGCAGCAGCAAAGTGAACAG
CCAGTCACATCTCCTCGGCAGGGCGGAGTCCTTGATGATGACATTCATTCAGCGCCCGAGCCGCCATCAGACTTG
CGTGAAAAGGACGATCGTAGGGAGTCATCTACAAGTGCCGGCACCGCTACAGCTCGTAGCTTCCGAGAACTTCAC
AGAAGATACTCCTCGGCTCAAGCGGCTAGAAGCGTGTCAGCTGGCGGAAGACTCGCTATTCCCTCCGATGGCGAA
AGCGAAGCTGCTGTCAGCCTGACTGAAGGAGGCAAATCACCTCGCCCCACCGGGCCTGATGCAGAGGATGTTAAG
GGCAAAAAAAAAGCCTCTTCTCGACAAACGCCTCTACAGGAGTCAACGCGCAACGGTGAGTCGACAGACGATGGA
AGCTGCAGCACAGGCGACAAAGCTTTACTGGAGACGAACCAGCTTTCTGGCCAACCAGTTCAAGCCATCGTGAAC
GCCTGA
Gene >Hirsu2|1080
ATGCCATCACTCCGTCGTCGAGGAAAAGTGGTCAGTGAGACAGATATGCGACGGCATACTTCTCCGGCGACAACA
GCATTTGACAACAACCCCAATACCAGCGGCCCTTCAAGTAAGACTGGACAGGAAATCAATCATATCAAACGCCAG
CCACAGCCCAAACCGTCCTTGCCTTCGGTACAGCAACAGGACTATGGCAAGCGACATGAACAATTGCAATTGTAC
CCCTCTCTCTCAGAGACTGTCTGGCCAGAGCCATCGAACCGCGACTCCGAACCTGCCGCCCCCACTTCAGATGCC
TCTCCTGCCGATGCCAAACTCGGCTCCAACAGGCATCGGCGCTTTTCGGTGTTACGTTTTCGCAATGCATCCGAC
TCGCAACTCTCCCTCAGGGCTAAACAGCAAGCTGAGAAACCACCCCCCGTTCCAACGCGTAGGTCAATCCGGGTC
CTCGTGTCCTCCCCGCTCTTACCCGAGCTTCCAACCTGCTAACTTCATGTGCCCAGCCCCTTCCATCATCACTAC
AGCCCCGACGAGCGATGCATCCGGGCCCAGAAAAATGACGTCTCGTATGAGCCTCGCTGCAAAATTCCGCCGGTC
TACCGAGGTTCAGCGAAAGGATGCTGCAGGTGCCAAGACCCAGGGACTCCTCCCAAAGCCGCCGACTGAAAGAAG
GAGCCGGCCATCTCTTACGACATCCGCTCATCCTCCTCCACCGTCCTGGCTAATGTCCGGCTCGGATGGCGCCAC
TCTGGGAGTGTCGAATAACCGTCGATCCGAATCATCCAAATCTGACGCAAGCTCCGCAGATCGCTCTACCCACCC
AAACCCACCATTCATTGAGAAGAAGGCTCAAATTCCAACCTCATTTTTCAAGCTGGGCAGGGCGAGGAAGTCTCC
CGAGAGCATGTTCCCCCTGGCACACCTCCCGCAAAAAAATGCCGCTCCGTCTGCGAGCGGATCTGCATTATCTCT
CCGTGCGGATCAGACGCCACGCCCTAGCTCGGCCCAGAGTGCATCGACCTCACGTGCCTGTGCTGATCAGTGCGA
CCACGGCTCAGCTATCTCAGCCGCTAATACTGCCACTCGGCTGTGTCGTGGCAACGCTCCTCATTCAAATCACTC
GTCACCCACTCGATCCAACCTGCTCAGAGGTCGATCTTCGACGATGAGCTCTATAGGTCTCGAGTCAGCCGACGA
CCATCTCTTACCACCTACGACTCGGACATCAACCTCAACAGGCCGGAAGAGTTTTGGCGATTTGCTGGGGCTAAG
CCGCATACGCCAAACCTCCGATCTTAGCAGGCAGGGTTCATCGACGCCCGTCACCCCCGGGTCTATCACCTCCAA
ACGCAACTCCTTCCAGCTCCAGAGAGGGGTCATTTCACTACCAGAACGACTTGATGACGAATCCCCGGCCAAGTT
CCTTGCGCGACTCGAGGACCTTCTCAATCGTGGTACACTTGCATCCGCTCTGTCCAAGGGAACCGATTTGTTCTC
GGCCGCCGTACTGAGAAGCTACATGCGACGCTTCAGTTTCTTCGGCGACCCAATGGATATGGCTCTAAGAAAACT
TCTGATGGAGGCTGAGTTGCCGAAAGAAACGCAGCAGATTGATAGGTGCCTTCAGGCGTTTGCCAACCGGTATCA
CGAGTGCAATCCTGGCATTTATTCATCTTCAGAACAAGCCTATTTCATAGCTTTCTCACTCTTGATTCTCCACAC
AGACGTTTTCAATAAAAACAACAAACACAAGATGCAAAAGTCGGACTATTTGAAGAATACTCGTGGAGAGGGCAT
TTTTGATGAGATACTCGAATGCTTTTATGACAATATCTCTTACACGCCATTCATTCATGTTGAGGACGATGTAGA
CGTCAGCCAGGATCGGCCTGTGACTAACAAATCGAAGAAGAGGCAGCGCCCCTCTTCAAGGGTCAGCGATTCTGC
CAAACGTGCCGCCAAGGAACCTGTTGACCCATACACAATCATATTGGACGGCAACCTTGATGCTCTTCGGCCCAA
CTGGAAGGACGCCATGCACCTGGATGATAATTACAACTACTTGGGTAGTGCCGCAGGTCTGAACTTAAGAGACTT
GCAAAAGACGTTCTTTAGAACTGCGGTGCTTCAGATCGTTTCGGCCAGGTCTCGCCCCGATGCGTTTATGACAGA
GAGGACGGCCTCCAATCCCGAGGACGCTCATCCAGGCATTGTGGATATCAAAATTACCAAGGTTGGTCTGCTGTG
GCGAAAAGATACCAAGAAAAGGAAGACACGATCTCCGTGGCAAGAATGGGGGGCCATCCTCACAGGGGCCCAACT
ATACTTCTTTAGGAACACCAGTTGGGTGAAGAGCCTGATGCAGCAGTACGAAAATCATATTAAAGCCGGGCATGA
CGGGATCCCAATCATTTTCAAGCCCCCTTTAGAGGAATTCAAACCAGACGCGTTGATGTCGACGCAGGGCGCCGT
AGCTCTTCTGGACGCGACGTACAAAAAGCACAAGAACGCCTTTGTCTATGTGCGGCAGGGTGTCGTGGACGAAGT
CCTACTTGCGGATAACGAGGATGAGAGAAATGACTGGCTCGCCAAATTGAACTACGCGGCTGCGTTTCGGACGTC
CGGGGTGAGGATGCGAGGCGTTGTCGGGGGCAACTACGATGGCCAGGGTCGTCGTGGAATTAGGCGCCTTGATAC
CTCTGACGCGACGCAACTTGTCCAAACGCCAACCGGGCCGGTTTCGATAGTGCGTGGCCGGATCGATCACAAAAT
GGCGCAAGATATCCAAGCAGCCCGGCGAGTTGGCATACAGCGTAAAATTGCAGAAGCAGACCGCAAGGTCGAGGA
CGCCCAGAGACAACTCGAGGAACAGCTCCGAAATGCCCGTCATCTCCAGATTTTGGCCCCAATTCAACCCAGGAC
GCGGGACTTGCTGCTACTTGCCGCAGCTCGCATGGCCGCGCAGCTCAAATGGACTCGCATGGTCATCTGGAAAGA
AAGGTGTCATCGCGACATCCTTAAACAAGACCTTGCAGACGATAGGCCCTTGTCAGCATCAACGGTCACACCTAC
CAGAAGTCAACCAGAACTCGATCTGCTGTCGCCACCCACACCAAGACCACTGGCCACGAACCTTGAGTCCGAACC
TAGTCAGCGTGCCTCAGTTGATGTCAACGCGCAAATATCCACGCAAATATCCACGAATTCGGATAGTATTTGCAT
CTGCAGCGAGGTCGATGCGCCTCGCGATAGAGAGTCAACTGATATCGAAAGTTCCCAGACACCGTCTCAGAGCGC
CACCAGGTTTCGTCAGGGATCGAACTCGCCATCCTATATAGAAGGTACAACGCAAGAACCAGTTTTGTGCTCAAA
TTCTTCCCTTCTGCCGTCTCCCACGGCACCGCCTCATTTGCGACCAATCTCCCCTAAGGAGAGGAGAAACATAGC
AATCCCAAGCGGCTCAAGTCGCAGCCTCGACGAAGTCGATGCCGACGAACGCGACTTCTTGAAGCAAACAGGGCT
GTGGGAAGCTGAGCCCGGCAGAGGGTCAATCGACAAGATAACTATGTCGACGTCTGCGGAGAGCGCAGACCATGG
CTCACTCGCTGATCGCGATAGATCGGAAAGGATGAAGGCACGACGGAGTTTGCAGCGCACCTTGAGAGAAAGTGC
TGGCCATTTGTCACACCACAGGGGCAGGAAGGGCAAAGAGGCCGTTCACGGTGGAGGGCTTGATGATGGACCGCT
CGATACCACACTCACACGTGGCACAGGAAGCTTCGTTGTTCATGGCAAGAAAGCGTCAGTCATAAAACTGGGCAC
AGAGCTTCAAAGCATGTCTCAAGATGAGATCTTTGTTCGCAAGCAGCTGCAGCAGCAGCAGCAAAGTGAACAGCC
AGTCACATCTCCTCGGCAGGGCGGAGTCCTTGATGATGACATTCATTCAGCGCCCGAGCCGCCATCAGACTTGCG
TGAAAAGGACGATCGTAGGGAGTCATCTACAAGTGCCGGCACCGCTACAGCTCGTAGCTTCCGAGAACTTCACAG
AAGATACTCCTCGGCTCAAGCGGCTAGAAGCGTGTCAGCTGGCGGAAGACTCGCTATTCCCTCCGATGGCGAAAG
CGAAGCTGCTGTCAGCCTGACTGAAGGAGGCAAATCACCTCGCCCCACCGGGCCTGATGCAGAGGATGTTAAGGG
CAAAAAAAAAGCCTCTTCTCGACAAACGCCTCTACAGGAGTCAACGCGCAACGGTGAGTCGACAGACGATGGAAG
CTGCAGCACAGGCGACAAAGCTTTACTGGAGACGAACCAGCTTTCTGGCCAACCAGTTCAAGCCATCGTGAACGC
CTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail