Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10780
Gene name
LocationContig_90:38651..40093
Strand+
Gene length (bp)1442
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18388 Atg29_N Atg29 N-terminal domain 1.1E-25 2 54

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A7KAN7|ATG29_PENRW Autophagy-related protein 29 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg29 PE=3 SV=1 2 396 1.0E-48
sp|Q6FK11|ATG29_CANGA Autophagy-related protein 29 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG29 PE=3 SV=1 4 93 6.0E-08
sp|Q75F26|ATG29_ASHGO Autophagy-related protein 29 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG29 PE=3 SV=1 3 86 1.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10780
MYTIFVRVPIPRGSFVDPPPVHWDSSKDDALWKILSGAAQTDIDWHQVADRFDVPVDFLLQQVAYLTERHASQVR
AQVRKATAAARGSAAPSPVPGAEHPRATSALSVRRDSPMTRHDSGSTVTSPLAGSGRPATSRNTSANTAVQRDAS
GSSGRLPVATRAIDTSGRRRLSSLPISPAARSPETTPGAEQARAASPGPAESNSTTSSDDEGSSPAQSRIIRRPP
RFQQQEPTQSYPGGDDDDGEESEPAFRLYQATADQASAQDLASTLRGDGRVVQERGYKSPTKDVALQSLTSDSSA
SSAAILHRPSKSRDQKAVGPLSPRRTAELAGRSPGGKGRALSREGSEGTPSMGSSFSDLDDASVTQSALEEALAS
HMGRGAISSRFSISQAFRSRYNPGPNQ*
Coding >Hirsu2|10780
ATGTATACCATCTTCGTGCGCGTGCCGATTCCGCGCGGAAGCTTTGTCGATCCCCCGCCGGTGCACTGGGACTCG
AGCAAAGACGACGCTCTCTGGAAGATTCTCTCGGGTGCCGCACAGACCGATATAGACTGGCATCAGGTAGCCGAC
CGCTTCGATGTGCCCGTCGACTTTCTGCTTCAGCAGGTGGCCTACCTGACAGAGCGGCATGCATCGCAGGTCCGT
GCCCAGGTTCGCAAGGCCACGGCGGCTGCCAGAGGCTCCGCCGCCCCGTCACCCGTCCCAGGCGCCGAGCACCCG
CGAGCCACATCGGCCTTGTCCGTCCGGCGCGACTCGCCCATGACACGTCACGACAGCGGCAGCACCGTCACCTCG
CCTCTCGCTGGATCGGGACGGCCGGCCACGTCGCGCAACACGTCGGCCAACACGGCGGTTCAGAGAGACGCTAGC
GGGTCATCCGGGAGACTGCCCGTCGCGACCCGTGCCATCGATACAAGCGGCCGGAGACGCCTGTCGTCGCTGCCA
ATCTCACCGGCCGCCAGGTCTCCCGAAACGACACCCGGGGCCGAGCAGGCGAGAGCGGCGTCGCCGGGTCCGGCC
GAGTCCAACTCGACGACGTCGTCGGATGATGAGGGGTCGAGTCCCGCCCAGTCCCGCATCATCCGTCGACCGCCA
CGGTTCCAGCAGCAGGAACCTACTCAGTCGTATCCGGGCGGGGACGACGACGACGGGGAAGAATCGGAGCCAGCC
TTCCGTCTGTACCAAGCCACAGCAGACCAGGCATCGGCCCAAGACCTGGCCTCGACGCTCAGGGGCGATGGCCGA
GTTGTCCAAGAGCGCGGCTACAAGAGCCCGACCAAGGATGTGGCCCTGCAATCTCTGACTTCCGACTCCTCGGCA
AGCTCGGCCGCCATTCTCCACCGTCCCAGCAAATCCCGCGACCAGAAAGCAGTCGGCCCGCTGTCGCCGCGCCGG
ACCGCCGAGTTGGCCGGGCGCAGCCCAGGCGGCAAGGGCAGGGCCTTGTCGCGGGAGGGCAGCGAGGGCACGCCG
AGCATGGGGAGCAGCTTCAGCGACCTCGACGATGCATCCGTGACCCAGTCGGCGCTGGAAGAGGCCTTGGCCAGC
CACATGGGCCGCGGGGCCATCAGCAGCCGCTTCAGCATCAGCCAGGCCTTTCGTAGTCGTTACAACCCGGGCCCA
AACCAGTGA
Transcript >Hirsu2|10780
ATGTATACCATCTTCGTGCGCGTGCCGATTCCGCGCGGAAGCTTTGTCGATCCCCCGCCGGTGCACTGGGACTCG
AGCAAAGACGACGCTCTCTGGAAGATTCTCTCGGGTGCCGCACAGACCGATATAGACTGGCATCAGGTAGCCGAC
CGCTTCGATGTGCCCGTCGACTTTCTGCTTCAGCAGGTGGCCTACCTGACAGAGCGGCATGCATCGCAGGTCCGT
GCCCAGGTTCGCAAGGCCACGGCGGCTGCCAGAGGCTCCGCCGCCCCGTCACCCGTCCCAGGCGCCGAGCACCCG
CGAGCCACATCGGCCTTGTCCGTCCGGCGCGACTCGCCCATGACACGTCACGACAGCGGCAGCACCGTCACCTCG
CCTCTCGCTGGATCGGGACGGCCGGCCACGTCGCGCAACACGTCGGCCAACACGGCGGTTCAGAGAGACGCTAGC
GGGTCATCCGGGAGACTGCCCGTCGCGACCCGTGCCATCGATACAAGCGGCCGGAGACGCCTGTCGTCGCTGCCA
ATCTCACCGGCCGCCAGGTCTCCCGAAACGACACCCGGGGCCGAGCAGGCGAGAGCGGCGTCGCCGGGTCCGGCC
GAGTCCAACTCGACGACGTCGTCGGATGATGAGGGGTCGAGTCCCGCCCAGTCCCGCATCATCCGTCGACCGCCA
CGGTTCCAGCAGCAGGAACCTACTCAGTCGTATCCGGGCGGGGACGACGACGACGGGGAAGAATCGGAGCCAGCC
TTCCGTCTGTACCAAGCCACAGCAGACCAGGCATCGGCCCAAGACCTGGCCTCGACGCTCAGGGGCGATGGCCGA
GTTGTCCAAGAGCGCGGCTACAAGAGCCCGACCAAGGATGTGGCCCTGCAATCTCTGACTTCCGACTCCTCGGCA
AGCTCGGCCGCCATTCTCCACCGTCCCAGCAAATCCCGCGACCAGAAAGCAGTCGGCCCGCTGTCGCCGCGCCGG
ACCGCCGAGTTGGCCGGGCGCAGCCCAGGCGGCAAGGGCAGGGCCTTGTCGCGGGAGGGCAGCGAGGGCACGCCG
AGCATGGGGAGCAGCTTCAGCGACCTCGACGATGCATCCGTGACCCAGTCGGCGCTGGAAGAGGCCTTGGCCAGC
CACATGGGCCGCGGGGCCATCAGCAGCCGCTTCAGCATCAGCCAGGCCTTTCGTAGTCGTTACAACCCGGGCCCA
AACCAGTGA
Gene >Hirsu2|10780
ATGTATACCATCTTCGTGCGCGTGCCGATTCCGCGCGGAAGCTTTGTCGATCCCCCGCCGGTACGTGAATCCAGC
TGCGCTACCGGGCCGCCGACCGTCGCTCACCAACTAGGTGCACTGGGACTCGAGCAAAGACGACGCTCTCTGGAA
GATTCTCTCGGGTGCCGCACAGACCGATATAGACTGTGAGTCTCTGCCGCCTCACCATCTCTCGTCATTTCCACG
TCCCGCTGACAATCAGGGCAGGGCATCAGGTGTAGGTGTCCCGCCCGGGCCGACACCTGTACCCCGACGAGCGGG
CTGACTTTACGCAGAGCCGACCGCTTCGATGTGCCCGTCGACTTTCTGCTTCAGCAGGTGGCCTACCTGACAGAG
CGGCATGCATCGCAGGTCCGTGCCCAGGTTCGCAAGGCCACGGCGGCTGCCAGAGGCTCCGCCGCCCCGTCACCC
GTCCCAGGCGCCGAGCACCCGCGAGCCACATCGGCCTTGTCCGTCCGGCGCGACTCGCCCATGACACGTCACGAC
AGCGGCAGCACCGTCACCTCGCCTCTCGCTGGATCGGGACGGCCGGCCACGTCGCGCAACACGTCGGCCAACACG
GCGGTTCAGAGAGACGCTAGCGGGTCATCCGGGAGACTGCCCGTCGCGACCCGTGCCATCGATACAAGCGGCCGG
AGACGCCTGTCGTCGCTGCCAATCTCACCGGCCGCCAGGTCTCCCGAAACGACACCCGGGGCCGAGCAGGCGAGA
GCGGCGTCGCCGGGTCCGGCCGAGTCCAACTCGACGACGTCGTCGGATGATGAGGGGTCGAGTCCCGCCCAGTCC
CGCATCATCCGTCGACCGCCACGGTTCCAGCAGCAGGAACCTACTCAGTCGTATCCGGGCGGGGACGACGACGAC
GGGGAAGAATCGGAGCCAGCCTTCCGTCTGTACCAAGCCACAGCAGACCAGGCATCGGCCCAAGACCTGGCCTCG
ACGCTCAGGGGCGATGGCCGAGTTGTCCAAGAGCGCGGCTACAAGAGCCCGACCAAGGATGTGGCCCTGCAATCT
CTGACTTCCGACTCCTCGGCAAGCTCGGCCGCCATTCTCCACCGTCCCAGCAAATCCCGCGACCAGAAAGCAGTC
GGCCCGCTGTCGCCGCGCCGGACCGCCGAGTTGGCCGGGCGCAGCCCAGGCGGCAAGGGCAGGGCCTTGTCGCGG
GAGGGCAGCGAGGGCACGCCGAGCATGGGGAGCAGCTTCAGCGACCTCGACGGTAATGCGCAGAACCCCTCGTAC
GGACCCAAAGCCCGTCCCCTTGACTGACGGGTTCAACAGATGCATCCGTGACCCAGTCGGCGCTGGAAGAGGCCT
TGGCCAGCCACATGGGCCGCGGGGCCATCAGCAGCCGCTTCAGCATCAGCCAGGCCTTTCGTAGTCGTTACAACC
CGGGCCCAAACCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail