Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10778
Gene name
LocationContig_90:29779..32156
Strand-
Gene length (bp)2377
Transcript length (bp)2190
Coding sequence length (bp)2190
Protein length (aa) 730

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03190 Thioredox_DsbH Protein of unknown function, DUF255 2.3E-53 31 201

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q80YT5|SPT20_MOUSE Spermatogenesis-associated protein 20 OS=Mus musculus GN=Spata20 PE=1 SV=1 2 707 8.0E-95
sp|Q6T393|SPT20_RAT Spermatogenesis-associated protein 20 OS=Rattus norvegicus GN=Spata20 PE=1 SV=1 6 707 4.0E-94
sp|Q8TB22|SPT20_HUMAN Spermatogenesis-associated protein 20 OS=Homo sapiens GN=SPATA20 PE=2 SV=3 6 707 1.0E-93
sp|Q09214|YP65_CAEEL Uncharacterized protein B0495.5 OS=Caenorhabditis elegans GN=B0495.5 PE=4 SV=2 25 713 2.0E-86
sp|P37512|YYAL_BACSU Uncharacterized protein YyaL OS=Bacillus subtilis (strain 168) GN=yyaL PE=4 SV=1 32 698 9.0E-81

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10778
MAAVHVRDSLPADGGESERAEGAARQQPPLRNRASSSKSPFVRGAQDSLVKWQLLDWESLDRAEKENKLIFLHIG
YRACHFSRVMALESFSNPECAALLNRHFIPVIVDREECPDIDTIYMNYVQAINGDGGWPLNVFLTPALGPVFGGT
RWFGPSTTRRAGADPENGAPDFLTILQRMRRVWTDQEVKCRLEATDVVSQLRQFAAEGTLGTRQIEVQAGLIPSG
WAVLALAPASAAVTSNRNAPLSTELDLDQLEEAYTYMKTMFDSVNGGFGTAPKFVTPPRLAFLLHLHRHPTPVQD
VVGQADCRRAAELTLFTLRKIRDGALHDHVGGAGFSRCSVTPDWSIPNFEKLVVDNALLLGLYLDAWLFSGGRAD
SEFFDVVEELVDYLTSAPIARPDGCLVSSEAADSYYRRGDADMREGAYYVWTRREFDSVLDAADRRISPVAAAYW
DVREDGNVREDYDLSDEFVNQNILRVVKQPAELAAQFDLPLATVEQYIQVAKRALRGRRERERVRPDLDDKVVTS
FNGLAISALARAGAALRAVAPHAAQRCLDTASAAVGFIERNLWDGEARLLYRIWNEGRATEGLADDYAYLILGLL
DLFEAAGDEKLVEFADMLQKVQNGLFHDHDGGFYSTTASSPHAILRLKDGMDTSLPSTNAVSAGNLARLGALLDD
CYFAGQARGTVNAFEAELLEHPGLFPGLLGALVMARLGVAAGGRRVVAYREARI*
Coding >Hirsu2|10778
ATGGCTGCCGTCCATGTGCGCGACTCGCTTCCAGCAGATGGGGGCGAGTCCGAGAGAGCAGAGGGAGCGGCGCGT
CAGCAACCACCGCTTCGGAATCGGGCGAGCTCCAGCAAAAGCCCCTTCGTGAGGGGCGCACAAGACAGTCTGGTA
AAATGGCAGCTCTTGGACTGGGAGAGCTTGGACCGGGCCGAGAAGGAGAACAAGCTCATCTTCCTTCATATTGGC
TATCGAGCTTGCCACTTTTCTCGAGTCATGGCTCTCGAATCCTTCTCGAACCCCGAATGCGCCGCCTTGCTCAAC
CGCCACTTCATTCCCGTCATCGTCGACCGAGAGGAGTGCCCCGACATCGACACCATCTACATGAACTATGTCCAG
GCCATCAACGGGGACGGAGGCTGGCCCCTCAACGTCTTCCTGACGCCCGCCCTGGGGCCCGTCTTCGGAGGCACC
CGCTGGTTCGGGCCGAGCACGACGCGGCGTGCGGGCGCAGACCCCGAGAACGGAGCGCCGGACTTCCTCACCATT
CTCCAGCGGATGCGCCGAGTCTGGACGGACCAGGAGGTCAAGTGCCGCCTGGAGGCGACAGACGTCGTGTCCCAG
CTGCGACAGTTCGCCGCCGAGGGCACCCTCGGTACCAGGCAGATAGAAGTCCAAGCCGGCCTCATACCTTCAGGA
TGGGCCGTCCTGGCGCTGGCGCCGGCAAGCGCCGCCGTGACGAGCAATAGGAACGCTCCCCTGTCCACCGAACTG
GACTTGGACCAGCTGGAAGAGGCCTACACATACATGAAGACCATGTTCGACAGCGTCAACGGTGGGTTCGGCACT
GCGCCCAAGTTCGTGACACCGCCCAGGTTGGCCTTCCTGCTGCACCTGCACCGACACCCGACGCCCGTGCAGGAC
GTGGTCGGGCAGGCCGACTGCCGACGCGCGGCCGAGCTCACGCTCTTCACGCTGCGCAAGATCCGCGATGGCGCC
CTGCACGACCACGTAGGCGGCGCCGGCTTCTCGCGCTGCTCCGTCACGCCCGACTGGAGCATCCCCAACTTCGAG
AAGCTGGTCGTTGACAACGCTTTGCTGCTAGGCCTCTACCTCGACGCCTGGCTCTTCTCCGGCGGCCGGGCCGAC
AGCGAGTTCTTCGACGTGGTCGAGGAGCTCGTCGACTACCTGACGTCGGCGCCCATCGCCCGGCCCGACGGGTGC
CTCGTCTCCAGCGAGGCGGCCGACTCGTACTACCGGCGCGGCGACGCCGACATGCGCGAGGGCGCCTACTACGTC
TGGACCCGGCGTGAGTTCGACTCTGTCCTGGACGCGGCCGACCGGCGCATCAGCCCCGTCGCCGCCGCGTACTGG
GATGTGCGGGAAGACGGCAACGTGCGGGAGGACTACGACCTCAGTGACGAATTCGTGAACCAGAACATCCTGCGG
GTCGTCAAGCAGCCGGCCGAGCTGGCCGCGCAGTTCGACCTGCCGCTCGCGACGGTGGAGCAGTACATCCAGGTC
GCCAAGCGGGCGCTCAGGGGCCGGCGGGAGCGGGAGCGCGTCAGGCCCGACCTGGACGACAAGGTGGTCACGAGC
TTCAACGGACTGGCCATCTCCGCCCTGGCGCGGGCGGGGGCGGCCTTGAGGGCCGTGGCGCCGCACGCGGCCCAG
CGGTGCCTCGACACGGCGAGCGCGGCCGTCGGCTTCATCGAGAGGAACCTCTGGGACGGCGAGGCCAGGCTGCTG
TACCGGATCTGGAACGAGGGGAGGGCGACCGAGGGCCTGGCCGACGACTACGCGTACCTCATCCTCGGCCTGCTC
GACCTGTTTGAGGCGGCGGGCGACGAGAAGCTGGTCGAGTTTGCCGACATGCTTCAAAAGGTCCAGAACGGCCTG
TTCCACGACCACGACGGCGGCTTCTACTCGACGACGGCCTCGTCGCCGCACGCCATCCTGCGCCTCAAGGACGGC
ATGGACACGTCCCTGCCGTCGACCAACGCCGTCTCGGCCGGCAACCTGGCCCGCCTCGGCGCCCTGCTCGACGAC
TGCTACTTCGCCGGCCAGGCCCGCGGCACCGTCAACGCCTTCGAGGCCGAGCTGCTCGAGCACCCGGGCCTCTTC
CCGGGCCTCCTCGGCGCCCTCGTCATGGCCCGCCTCGGCGTCGCGGCCGGCGGCAGGCGCGTCGTCGCGTACAGG
GAGGCGCGCATCTAG
Transcript >Hirsu2|10778
ATGGCTGCCGTCCATGTGCGCGACTCGCTTCCAGCAGATGGGGGCGAGTCCGAGAGAGCAGAGGGAGCGGCGCGT
CAGCAACCACCGCTTCGGAATCGGGCGAGCTCCAGCAAAAGCCCCTTCGTGAGGGGCGCACAAGACAGTCTGGTA
AAATGGCAGCTCTTGGACTGGGAGAGCTTGGACCGGGCCGAGAAGGAGAACAAGCTCATCTTCCTTCATATTGGC
TATCGAGCTTGCCACTTTTCTCGAGTCATGGCTCTCGAATCCTTCTCGAACCCCGAATGCGCCGCCTTGCTCAAC
CGCCACTTCATTCCCGTCATCGTCGACCGAGAGGAGTGCCCCGACATCGACACCATCTACATGAACTATGTCCAG
GCCATCAACGGGGACGGAGGCTGGCCCCTCAACGTCTTCCTGACGCCCGCCCTGGGGCCCGTCTTCGGAGGCACC
CGCTGGTTCGGGCCGAGCACGACGCGGCGTGCGGGCGCAGACCCCGAGAACGGAGCGCCGGACTTCCTCACCATT
CTCCAGCGGATGCGCCGAGTCTGGACGGACCAGGAGGTCAAGTGCCGCCTGGAGGCGACAGACGTCGTGTCCCAG
CTGCGACAGTTCGCCGCCGAGGGCACCCTCGGTACCAGGCAGATAGAAGTCCAAGCCGGCCTCATACCTTCAGGA
TGGGCCGTCCTGGCGCTGGCGCCGGCAAGCGCCGCCGTGACGAGCAATAGGAACGCTCCCCTGTCCACCGAACTG
GACTTGGACCAGCTGGAAGAGGCCTACACATACATGAAGACCATGTTCGACAGCGTCAACGGTGGGTTCGGCACT
GCGCCCAAGTTCGTGACACCGCCCAGGTTGGCCTTCCTGCTGCACCTGCACCGACACCCGACGCCCGTGCAGGAC
GTGGTCGGGCAGGCCGACTGCCGACGCGCGGCCGAGCTCACGCTCTTCACGCTGCGCAAGATCCGCGATGGCGCC
CTGCACGACCACGTAGGCGGCGCCGGCTTCTCGCGCTGCTCCGTCACGCCCGACTGGAGCATCCCCAACTTCGAG
AAGCTGGTCGTTGACAACGCTTTGCTGCTAGGCCTCTACCTCGACGCCTGGCTCTTCTCCGGCGGCCGGGCCGAC
AGCGAGTTCTTCGACGTGGTCGAGGAGCTCGTCGACTACCTGACGTCGGCGCCCATCGCCCGGCCCGACGGGTGC
CTCGTCTCCAGCGAGGCGGCCGACTCGTACTACCGGCGCGGCGACGCCGACATGCGCGAGGGCGCCTACTACGTC
TGGACCCGGCGTGAGTTCGACTCTGTCCTGGACGCGGCCGACCGGCGCATCAGCCCCGTCGCCGCCGCGTACTGG
GATGTGCGGGAAGACGGCAACGTGCGGGAGGACTACGACCTCAGTGACGAATTCGTGAACCAGAACATCCTGCGG
GTCGTCAAGCAGCCGGCCGAGCTGGCCGCGCAGTTCGACCTGCCGCTCGCGACGGTGGAGCAGTACATCCAGGTC
GCCAAGCGGGCGCTCAGGGGCCGGCGGGAGCGGGAGCGCGTCAGGCCCGACCTGGACGACAAGGTGGTCACGAGC
TTCAACGGACTGGCCATCTCCGCCCTGGCGCGGGCGGGGGCGGCCTTGAGGGCCGTGGCGCCGCACGCGGCCCAG
CGGTGCCTCGACACGGCGAGCGCGGCCGTCGGCTTCATCGAGAGGAACCTCTGGGACGGCGAGGCCAGGCTGCTG
TACCGGATCTGGAACGAGGGGAGGGCGACCGAGGGCCTGGCCGACGACTACGCGTACCTCATCCTCGGCCTGCTC
GACCTGTTTGAGGCGGCGGGCGACGAGAAGCTGGTCGAGTTTGCCGACATGCTTCAAAAGGTCCAGAACGGCCTG
TTCCACGACCACGACGGCGGCTTCTACTCGACGACGGCCTCGTCGCCGCACGCCATCCTGCGCCTCAAGGACGGC
ATGGACACGTCCCTGCCGTCGACCAACGCCGTCTCGGCCGGCAACCTGGCCCGCCTCGGCGCCCTGCTCGACGAC
TGCTACTTCGCCGGCCAGGCCCGCGGCACCGTCAACGCCTTCGAGGCCGAGCTGCTCGAGCACCCGGGCCTCTTC
CCGGGCCTCCTCGGCGCCCTCGTCATGGCCCGCCTCGGCGTCGCGGCCGGCGGCAGGCGCGTCGTCGCGTACAGG
GAGGCGCGCATCTAG
Gene >Hirsu2|10778
ATGGCTGCCGTCCATGTGCGCGACTCGCTTCCAGCAGATGGGGGCGAGTCCGAGAGAGCAGAGGGAGCGGCGCGT
CAGCAACCACCGCTTCGGAATCGGGCGAGCTCCAGCAAAAGCCCCTTCGTGAGGGGCGCACAAGACAGTCTGGTA
AAATGGCAGCTCTTGGACTGGGAGAGCTTGGACCGGGCCGAGAAGGAGAACAAGCTCATCTTCCTTCATATTGGC
TATCGAGCTTGCCACTGTGCGCCTCCCCTCCCCTCTCTCCCCATACAAGACGGAGGTGACAGCGGTTGCTCATAC
ATGGGGAAAAATGGCCAGTTTCTCGAGTCATGGCTCTCGAATCCTTCTCGAACCCCGAATGCGCCGCCTTGCTCA
ACCGCCACTTCATTCCCGTCATCGTCGACCGAGAGGAGTGCCCCGACATCGACACCATCTACATGAACTATGTCC
AGGCCATCAACGGGGACGGAGGCTGGCCCCTCAACGTCTTCCTGACGCCCGCCCTGGGGCCCGTCTTCGGAGGCA
CCCGCTGGTTCGGGCCGAGCACGACGCGGCGTGCGGGCGCAGACCCCGAGAACGGAGCGCCGGACTTCCTCACCA
TTCTCCAGCGGATGCGCCGAGTCTGGACGGACCAGGAGGTCAAGTGCCGCCTGGAGGCGACAGACGTCGTGTCCC
AGCTGCGACAGTTCGCCGCCGAGGGCACCCTCGGTACCAGGCAGATAGAAGTCCAAGCCGGCCTCATACCTTCAG
GATGGGCCGTCCTGGCGCTGGCGCCGGCAAGCGCCGCCGTGACGAGCAATAGGAACGCTCCCCTGTCCACCGAAC
TGGACTTGGACCAGCTGGAAGAGGCCTACACATACATGAAGACCATGTTCGACAGCGTCAACGGTGGGTTCGGCA
CTGCGCCCAAGTTCGTGACACCGCCCAGGTTGGCCTTCCTGCTGCACCTGCACCGACACCCGACGCCCGTGCAGG
ACGTGGTCGGGCAGGCCGACTGCCGACGCGCGGCCGAGCTCACGCTCTTCACGCTGCGCAAGATCCGCGATGGCG
CCCTGCACGACCACGTAGGCGGCGCCGGCTTCTCGCGCTGCTCCGTCACGCCCGACTGGAGCATCCCCAACTTCG
AGAAGCTGGTCGTTGACAACGCTTTGCTGCTAGGCCTCTACCTCGACGCCTGGCTCTTCTCCGGCGGCCGGGCCG
ACAGCGAGTTCTTCGACGTGGTCGAGGAGCTCGTCGACTACCTGACGTCGGCGCCCATCGCCCGGCCCGACGGGT
GCCTCGTCTCCAGCGAGGCGGCCGACTCGTACTACCGGCGCGGCGACGCCGACATGCGCGAGGGCGCCTACTACG
TCTGGACCCGGCGTGAGTTCGACTCTGTCCTGGACGCGGCCGACCGGCGCATCAGCCCCGTCGCCGCCGCGTACT
GGGATGTGCGGGAAGACGGCAACGTGCGGGAGGACTACGACCTCAGTGACGAATTCGTGAACCAGAACATCCTGC
GGGTCGTCAAGCAGCCGGCCGAGCTGGCCGCGCAGTTCGACCTGCCGCTCGCGACGGTGGAGCAGTACATCCAGG
TCGCCAAGCGGGCGCTCAGGGGCCGGCGGGAGCGGGAGCGCGTCAGGCCCGACCTGGACGACAAGGTGGTCACGA
GCTTCAACGGACTGGCCATCTCCGCCCTGGCGCGGGCGGGGGCGGCCTTGAGGGCCGTGGCGCCGCACGCGGCCC
AGCGGTGCCTCGACACGGCGAGCGCGGCCGTCGGCTTCATCGAGAGGAACCTCTGGGACGGCGAGGCCAGGCTGC
TGTACCGGATCTGGAACGAGGGGAGGGCGACCGAGGGCCTGGCCGACGACTACGCGTACCTCATCCTCGGCCTGC
TCGACCTGTTTGAGGCGGCGGGCGACGAGAAGCTGGTCGAGTTTGCCGACATGCTTCAAAGTAAGCCACCCTCTC
TCTCCCTCTCCGTCCCTCTCTCTCCCTCTATCCCCCCCCCTCTCTCTATCCCTCTCTCGTGCCGTCTCTGACGCC
AGGCCCTCCCCCTCCCGCAGAGGTCCAGAACGGCCTGTTCCACGACCACGACGGCGGCTTCTACTCGACGACGGC
CTCGTCGCCGCACGCCATCCTGCGCCTCAAGGACGGCATGGACACGTCCCTGCCGTCGACCAACGCCGTCTCGGC
CGGCAACCTGGCCCGCCTCGGCGCCCTGCTCGACGACTGCTACTTCGCCGGCCAGGCCCGCGGCACCGTCAACGC
CTTCGAGGCCGAGCTGCTCGAGCACCCGGGCCTCTTCCCGGGCCTCCTCGGCGCCCTCGTCATGGCCCGCCTCGG
CGTCGCGGCCGGCGGCAGGCGCGTCGTCGCGTACAGGGAGGCGCGCATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail