Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1077
Gene name
LocationContig_1222:3549..4662
Strand-
Gene length (bp)1113
Transcript length (bp)1113
Coding sequence length (bp)1113
Protein length (aa) 371

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04433 SWIRM SWIRM domain 3.5E-13 290 362

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P28003|FUN19_YEAST SWIRM domain-containing protein FUN19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN19 PE=1 SV=3 253 370 4.0E-32
sp|Q99326|YO338_YEAST SWIRM domain-containing protein YOR338W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR338W PE=1 SV=1 253 361 7.0E-32
sp|O13719|LAF1_SCHPO SWIRM domain-containing protein laf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=laf1 PE=1 SV=1 145 362 3.0E-31
sp|O74443|LAF2_SCHPO SWIRM domain-containing protein laf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=laf2 PE=1 SV=1 253 362 5.0E-30
sp|Q59WH0|ADA2_CANAL Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADA2 PE=3 SV=1 281 360 2.0E-06

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1077
MEAKKLDINSLMSPPDALIDSFAHHHHHHAMSSGKGTGTGKAGDADFCPASSAQHPLPMSPPVSPYSKPATTSTS
PPSSQQTAVVVKDPVLYPVDDHSPSSPMQQPLFAPAELEHRRIVDEHVRARPQSIFAGLAPPRREDYELVLTFRS
QVMRHFTADRKAWLRKERALLEADRRAGAQRYHAIMPAKPVVAKSARSSRAERVTKGQGAPRQIRNHAAATGPAR
PARPAGRVSATPEPSRRIVAPNREDKDFEALPNYCPPTASLPNRPNSLKVDWKGQPIDLSNDANAHLLHPDEVTL
AGNLRLDCATYLTSKRRIFDRRLQCLRMGKEFRKTDAQQACKIDVNKASKLWTAFEKVGWLDASWMRDFV*
Coding >Hirsu2|1077
ATGGAAGCCAAGAAGCTCGACATCAACAGCCTCATGTCCCCCCCCGACGCACTCATCGACAGCTTCGCCCACCAC
CACCACCACCACGCCATGAGCAGCGGCAAGGGCACGGGCACGGGCAAGGCGGGCGACGCCGACTTCTGCCCGGCG
TCGTCGGCCCAGCACCCGCTGCCCATGTCGCCGCCCGTCTCGCCCTACAGCAAGCCGGCAACGACGTCGACGTCG
CCGCCGTCGAGCCAGCAGACGGCCGTCGTCGTCAAGGACCCGGTCCTGTACCCCGTCGACGACCACTCGCCGTCG
AGCCCGATGCAGCAGCCGCTCTTCGCCCCGGCCGAGCTCGAGCACCGGCGCATCGTCGACGAGCACGTGCGGGCG
CGGCCGCAGAGCATCTTCGCCGGCCTCGCACCCCCCCGACGCGAGGACTACGAGCTCGTCCTCACCTTCCGGTCG
CAGGTGATGAGGCACTTCACCGCCGACCGCAAGGCCTGGCTGCGCAAGGAGCGGGCTCTCCTCGAGGCAGACAGG
CGGGCCGGCGCCCAGCGATACCATGCCATCATGCCGGCCAAGCCCGTTGTGGCCAAGTCCGCCCGGTCGTCGCGT
GCCGAGCGAGTGACCAAGGGCCAGGGTGCCCCACGGCAGATCCGCAACCATGCCGCAGCCACGGGGCCTGCGAGA
CCAGCGAGACCCGCCGGCCGTGTTAGCGCCACGCCCGAGCCGTCGCGGCGGATCGTCGCGCCCAATCGCGAGGAC
AAGGACTTCGAGGCGCTGCCCAACTACTGCCCGCCCACGGCCTCGCTCCCCAACCGCCCCAACAGCCTCAAGGTG
GACTGGAAGGGCCAGCCGATCGACCTGAGCAACGACGCCAACGCCCACCTGCTGCACCCGGACGAGGTGACGCTG
GCCGGCAACCTCCGCCTCGACTGCGCCACGTACCTGACGAGCAAGCGGCGCATCTTCGACCGCCGCCTTCAGTGC
CTCCGCATGGGCAAGGAGTTCCGCAAGACGGACGCACAGCAGGCGTGCAAGATTGACGTCAACAAGGCCTCGAAG
CTGTGGACAGCCTTTGAGAAGGTGGGCTGGCTCGACGCCAGCTGGATGCGCGACTTTGTCTGA
Transcript >Hirsu2|1077
ATGGAAGCCAAGAAGCTCGACATCAACAGCCTCATGTCCCCCCCCGACGCACTCATCGACAGCTTCGCCCACCAC
CACCACCACCACGCCATGAGCAGCGGCAAGGGCACGGGCACGGGCAAGGCGGGCGACGCCGACTTCTGCCCGGCG
TCGTCGGCCCAGCACCCGCTGCCCATGTCGCCGCCCGTCTCGCCCTACAGCAAGCCGGCAACGACGTCGACGTCG
CCGCCGTCGAGCCAGCAGACGGCCGTCGTCGTCAAGGACCCGGTCCTGTACCCCGTCGACGACCACTCGCCGTCG
AGCCCGATGCAGCAGCCGCTCTTCGCCCCGGCCGAGCTCGAGCACCGGCGCATCGTCGACGAGCACGTGCGGGCG
CGGCCGCAGAGCATCTTCGCCGGCCTCGCACCCCCCCGACGCGAGGACTACGAGCTCGTCCTCACCTTCCGGTCG
CAGGTGATGAGGCACTTCACCGCCGACCGCAAGGCCTGGCTGCGCAAGGAGCGGGCTCTCCTCGAGGCAGACAGG
CGGGCCGGCGCCCAGCGATACCATGCCATCATGCCGGCCAAGCCCGTTGTGGCCAAGTCCGCCCGGTCGTCGCGT
GCCGAGCGAGTGACCAAGGGCCAGGGTGCCCCACGGCAGATCCGCAACCATGCCGCAGCCACGGGGCCTGCGAGA
CCAGCGAGACCCGCCGGCCGTGTTAGCGCCACGCCCGAGCCGTCGCGGCGGATCGTCGCGCCCAATCGCGAGGAC
AAGGACTTCGAGGCGCTGCCCAACTACTGCCCGCCCACGGCCTCGCTCCCCAACCGCCCCAACAGCCTCAAGGTG
GACTGGAAGGGCCAGCCGATCGACCTGAGCAACGACGCCAACGCCCACCTGCTGCACCCGGACGAGGTGACGCTG
GCCGGCAACCTCCGCCTCGACTGCGCCACGTACCTGACGAGCAAGCGGCGCATCTTCGACCGCCGCCTTCAGTGC
CTCCGCATGGGCAAGGAGTTCCGCAAGACGGACGCACAGCAGGCGTGCAAGATTGACGTCAACAAGGCCTCGAAG
CTGTGGACAGCCTTTGAGAAGGTGGGCTGGCTCGACGCCAGCTGGATGCGCGACTTTGTCTGA
Gene >Hirsu2|1077
ATGGAAGCCAAGAAGCTCGACATCAACAGCCTCATGTCCCCCCCCGACGCACTCATCGACAGCTTCGCCCACCAC
CACCACCACCACGCCATGAGCAGCGGCAAGGGCACGGGCACGGGCAAGGCGGGCGACGCCGACTTCTGCCCGGCG
TCGTCGGCCCAGCACCCGCTGCCCATGTCGCCGCCCGTCTCGCCCTACAGCAAGCCGGCAACGACGTCGACGTCG
CCGCCGTCGAGCCAGCAGACGGCCGTCGTCGTCAAGGACCCGGTCCTGTACCCCGTCGACGACCACTCGCCGTCG
AGCCCGATGCAGCAGCCGCTCTTCGCCCCGGCCGAGCTCGAGCACCGGCGCATCGTCGACGAGCACGTGCGGGCG
CGGCCGCAGAGCATCTTCGCCGGCCTCGCACCCCCCCGACGCGAGGACTACGAGCTCGTCCTCACCTTCCGGTCG
CAGGTGATGAGGCACTTCACCGCCGACCGCAAGGCCTGGCTGCGCAAGGAGCGGGCTCTCCTCGAGGCAGACAGG
CGGGCCGGCGCCCAGCGATACCATGCCATCATGCCGGCCAAGCCCGTTGTGGCCAAGTCCGCCCGGTCGTCGCGT
GCCGAGCGAGTGACCAAGGGCCAGGGTGCCCCACGGCAGATCCGCAACCATGCCGCAGCCACGGGGCCTGCGAGA
CCAGCGAGACCCGCCGGCCGTGTTAGCGCCACGCCCGAGCCGTCGCGGCGGATCGTCGCGCCCAATCGCGAGGAC
AAGGACTTCGAGGCGCTGCCCAACTACTGCCCGCCCACGGCCTCGCTCCCCAACCGCCCCAACAGCCTCAAGGTG
GACTGGAAGGGCCAGCCGATCGACCTGAGCAACGACGCCAACGCCCACCTGCTGCACCCGGACGAGGTGACGCTG
GCCGGCAACCTCCGCCTCGACTGCGCCACGTACCTGACGAGCAAGCGGCGCATCTTCGACCGCCGCCTTCAGTGC
CTCCGCATGGGCAAGGAGTTCCGCAAGACGGACGCACAGCAGGCGTGCAAGATTGACGTCAACAAGGCCTCGAAG
CTGTGGACAGCCTTTGAGAAGGTGGGCTGGCTCGACGCCAGCTGGATGCGCGACTTTGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail