Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10769
Gene name
LocationContig_90:1495..3252
Strand-
Gene length (bp)1757
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03798 TRAM_LAG1_CLN8 TLC domain 7.7E-49 151 380
PF08390 TRAM1 TRAM1-like protein 4.3E-20 89 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78970|LAG1_SCHPO Sphingosine N-acyltransferase lag1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lag1 PE=1 SV=2 83 410 9.0E-70
sp|A6ZSP9|LAG1_YEAS7 Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAG1 PE=3 SV=1 8 410 6.0E-37
sp|P38703|LAG1_YEAST Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAG1 PE=1 SV=1 8 410 9.0E-37
sp|P28496|LAC1_YEAST Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAC1 PE=1 SV=2 90 306 2.0E-33
sp|A6ZZV7|LAC1_YEAS7 Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAC1 PE=3 SV=1 90 306 2.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78970|LAG1_SCHPO Sphingosine N-acyltransferase lag1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lag1 PE=1 SV=2 83 410 9.0E-70
sp|A6ZSP9|LAG1_YEAS7 Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAG1 PE=3 SV=1 8 410 6.0E-37
sp|P38703|LAG1_YEAST Sphingosine N-acyltransferase LAG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAG1 PE=1 SV=1 8 410 9.0E-37
sp|P28496|LAC1_YEAST Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAC1 PE=1 SV=2 90 306 2.0E-33
sp|A6ZZV7|LAC1_YEAS7 Sphingosine N-acyltransferase LAC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=LAC1 PE=3 SV=1 90 306 2.0E-33
sp|O59735|LAC1_SCHPO Sphingosine N-acyltransferase lac1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lac1 PE=1 SV=2 95 313 1.0E-30
sp|G5ED45|HYL1_CAEEL Ceramide synthase hyl-1 OS=Caenorhabditis elegans GN=hyl-1 PE=1 SV=1 142 406 5.0E-21
sp|Q9LDF2|LAG11_ARATH LAG1 longevity assurance homolog 1 OS=Arabidopsis thaliana GN=LAG1 PE=2 SV=1 151 406 5.0E-21
sp|Q6EUN0|ASCL1_ORYSJ ASC1-like protein 1 OS=Oryza sativa subsp. japonica GN=Os02g0581300 PE=2 SV=1 146 406 4.0E-19
sp|Q9LJK3|LAG12_ARATH LAG1 longevity assurance homolog 2 OS=Arabidopsis thaliana GN=LAG2 PE=1 SV=1 139 403 8.0E-19
sp|Q7Z139|HYL2_CAEEL Ceramide synthase hyl-2 OS=Caenorhabditis elegans GN=hyl-2 PE=1 SV=1 136 299 8.0E-19
sp|Q84QC0|ASCL3_ORYSJ ASC1-like protein 3 OS=Oryza sativa subsp. japonica GN=Os03g0264000 PE=2 SV=1 144 402 9.0E-19
sp|Q6NQI8|LAG13_ARATH LAG1 longevity assurance homolog 3 OS=Arabidopsis thaliana GN=At1g13580 PE=2 SV=2 145 406 1.0E-18
sp|Q924Z4|CERS2_MOUSE Ceramide synthase 2 OS=Mus musculus GN=Cers2 PE=1 SV=1 137 397 1.0E-18
sp|Q96G23|CERS2_HUMAN Ceramide synthase 2 OS=Homo sapiens GN=CERS2 PE=1 SV=1 137 397 6.0E-18
sp|Q8N5B7|CERS5_HUMAN Ceramide synthase 5 OS=Homo sapiens GN=CERS5 PE=2 SV=1 148 299 8.0E-18
sp|Q3ZBF8|CERS2_BOVIN Ceramide synthase 2 OS=Bos taurus GN=CERS2 PE=2 SV=1 137 397 1.0E-17
sp|Q9D6J1|CERS4_MOUSE Ceramide synthase 4 OS=Mus musculus GN=Cers4 PE=1 SV=1 137 414 3.0E-17
sp|Q9M6A3|ASC1_SOLLC Protein ASC1 OS=Solanum lycopersicum GN=Asc-1 PE=2 SV=2 140 406 7.0E-17
sp|Q8W4Y5|ASCL_SOLLC ASC1-like protein OS=Solanum lycopersicum PE=2 SV=1 145 404 4.0E-16
sp|Q9D6K9|CERS5_MOUSE Ceramide synthase 5 OS=Mus musculus GN=Cers5 PE=1 SV=1 148 395 4.0E-16
sp|Q6ZMG9|CERS6_HUMAN Ceramide synthase 6 OS=Homo sapiens GN=CERS6 PE=1 SV=1 137 395 1.0E-15
sp|Q5E9R6|CERS4_BOVIN Ceramide synthase 4 OS=Bos taurus GN=CERS4 PE=2 SV=1 129 407 4.0E-15
sp|Q8C172|CERS6_MOUSE Ceramide synthase 6 OS=Mus musculus GN=Cers6 PE=1 SV=1 137 295 1.0E-14
sp|Q6YWS8|ASCL2_ORYSJ ASC1-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0728300 PE=3 SV=2 144 396 9.0E-14
sp|Q9HA82|CERS4_HUMAN Ceramide synthase 4 OS=Homo sapiens GN=CERS4 PE=1 SV=2 129 299 2.0E-12
sp|Q1A3B0|CERS3_MOUSE Ceramide synthase 3 OS=Mus musculus GN=Cers3 PE=1 SV=1 149 398 8.0E-12
sp|Q8IU89|CERS3_HUMAN Ceramide synthase 3 OS=Homo sapiens GN=CERS3 PE=1 SV=2 145 396 2.0E-10
sp|P27545|CERS1_MOUSE Ceramide synthase 1 OS=Mus musculus GN=Cers1 PE=1 SV=1 118 269 2.0E-08
sp|Q9XWE9|LAGR1_CAEEL Probable ceramide synthase lagr-1 OS=Caenorhabditis elegans GN=lagr-1 PE=3 SV=1 151 415 9.0E-08
sp|Q15035|TRAM2_HUMAN Translocating chain-associated membrane protein 2 OS=Homo sapiens GN=TRAM2 PE=1 SV=1 47 224 2.0E-06
sp|Q924Z5|TRAM2_MOUSE Translocating chain-associated membrane protein 2 OS=Mus musculus GN=Tram2 PE=1 SV=1 45 224 2.0E-06
sp|P27544|CERS1_HUMAN Ceramide synthase 1 OS=Homo sapiens GN=CERS1 PE=1 SV=1 123 269 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 113 135 22
3 156 173 17
4 201 218 17
5 250 267 17
6 282 304 22
7 356 378 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10769
MSDSERRESSPPLDRAAKSAARKTNMNGPLYMQTSGSNVVLVRRLKRRDDGTWRHLARWFVENQIGLSFNLLALL
FLAHSFIPKARIHTHKFFHLAYYNPETDKYGTGIDDAYFVAFCIVLFTGLRAGTMEHILAPFGRLQGLARRKVLT
RFSEQAWLLIYYSLFWTLGMYIYSTSPYFLNMRELWTDWPSREMDGLMKGYILAQWAFWLQQIIVINIEERRKDH
WQMSSHHIITTALISSCYCYHHTRVGNYILVIMDVVDLFLPLAKCLKYADYNTLCDVAFGVFMLVWFAARHVLYI
MVCWSVYAHTPNIMPTGCFTGSGAHPAGPEPTPSGLSYLIEPFLSASGRVCYSQTVKWAFLAPLLLLQVITIIWF
TMIVRIAVKVIRGDGAEDTRSDDEGDEEEEEEDDEFVYEEARPLEEEVGVEDLDLKGWERRAGVKRQASSSGVSL
PGHSDRKELLGRIGCEKQVD*
Coding >Hirsu2|10769
ATGAGCGATTCGGAGCGCCGCGAGTCGTCGCCTCCCCTCGACAGGGCCGCCAAATCCGCCGCGCGCAAGACCAAC
ATGAACGGCCCGCTCTACATGCAGACCTCGGGCAGCAACGTCGTCCTCGTCCGCCGCCTGAAGCGCAGAGACGAC
GGCACCTGGAGGCACCTGGCCCGCTGGTTCGTCGAGAACCAGATCGGCCTGTCCTTCAACCTCCTCGCCCTCCTC
TTCCTCGCCCACAGCTTCATCCCCAAGGCCCGGATACATACCCACAAGTTCTTCCACCTGGCCTACTACAACCCA
GAGACGGACAAGTATGGCACCGGCATCGACGACGCATACTTCGTCGCCTTCTGCATCGTCCTCTTCACCGGCCTG
CGCGCCGGCACCATGGAACACATCCTCGCCCCCTTCGGCCGCCTCCAGGGCCTCGCCCGCCGCAAGGTCTTGACG
CGCTTCAGCGAGCAGGCCTGGCTGCTCATCTACTACAGCCTCTTCTGGACGCTCGGCATGTACATCTACTCGACC
TCGCCCTACTTCCTCAACATGCGCGAGCTCTGGACCGACTGGCCCAGCCGCGAGATGGACGGCCTGATGAAGGGC
TACATCCTCGCCCAGTGGGCCTTTTGGCTGCAGCAGATCATCGTCATCAACATCGAGGAGCGCCGCAAGGACCAC
TGGCAGATGTCCAGCCACCACATCATCACCACCGCCCTCATCTCCTCGTGCTACTGCTACCACCACACCCGCGTC
GGCAACTACATCCTCGTCATCATGGACGTCGTCGACCTGTTTCTGCCCCTGGCCAAGTGCCTCAAGTACGCCGAC
TACAACACGCTCTGCGACGTCGCCTTTGGCGTCTTCATGCTCGTCTGGTTCGCCGCCCGCCACGTCCTCTACATC
ATGGTCTGCTGGTCCGTCTACGCGCACACGCCCAACATCATGCCCACCGGCTGCTTCACCGGCAGCGGAGCCCAC
CCGGCCGGGCCGGAGCCGACGCCGTCGGGCCTGTCGTACCTCATCGAGCCCTTCCTCAGCGCCAGCGGCCGCGTC
TGCTACAGCCAGACGGTCAAGTGGGCCTTTTTGGCCCCGCTCCTGCTCCTGCAGGTCATCACCATAATCTGGTTC
ACCATGATTGTCCGCATCGCCGTCAAGGTCATCCGCGGCGACGGCGCCGAGGACACGCGCAGCGACGACGAGGGC
GACGAGGAGGAGGAGGAAGAGGACGACGAGTTCGTCTACGAGGAGGCCCGGCCGCTTGAGGAGGAGGTGGGCGTC
GAGGACCTCGACCTCAAGGGCTGGGAGCGCCGGGCCGGGGTTAAGCGCCAGGCCAGCAGCTCGGGAGTGAGCCTG
CCGGGGCACAGCGACCGAAAGGAGCTGCTCGGCCGCATCGGCTGCGAGAAGCAGGTCGACTGA
Transcript >Hirsu2|10769
ATGAGCGATTCGGAGCGCCGCGAGTCGTCGCCTCCCCTCGACAGGGCCGCCAAATCCGCCGCGCGCAAGACCAAC
ATGAACGGCCCGCTCTACATGCAGACCTCGGGCAGCAACGTCGTCCTCGTCCGCCGCCTGAAGCGCAGAGACGAC
GGCACCTGGAGGCACCTGGCCCGCTGGTTCGTCGAGAACCAGATCGGCCTGTCCTTCAACCTCCTCGCCCTCCTC
TTCCTCGCCCACAGCTTCATCCCCAAGGCCCGGATACATACCCACAAGTTCTTCCACCTGGCCTACTACAACCCA
GAGACGGACAAGTATGGCACCGGCATCGACGACGCATACTTCGTCGCCTTCTGCATCGTCCTCTTCACCGGCCTG
CGCGCCGGCACCATGGAACACATCCTCGCCCCCTTCGGCCGCCTCCAGGGCCTCGCCCGCCGCAAGGTCTTGACG
CGCTTCAGCGAGCAGGCCTGGCTGCTCATCTACTACAGCCTCTTCTGGACGCTCGGCATGTACATCTACTCGACC
TCGCCCTACTTCCTCAACATGCGCGAGCTCTGGACCGACTGGCCCAGCCGCGAGATGGACGGCCTGATGAAGGGC
TACATCCTCGCCCAGTGGGCCTTTTGGCTGCAGCAGATCATCGTCATCAACATCGAGGAGCGCCGCAAGGACCAC
TGGCAGATGTCCAGCCACCACATCATCACCACCGCCCTCATCTCCTCGTGCTACTGCTACCACCACACCCGCGTC
GGCAACTACATCCTCGTCATCATGGACGTCGTCGACCTGTTTCTGCCCCTGGCCAAGTGCCTCAAGTACGCCGAC
TACAACACGCTCTGCGACGTCGCCTTTGGCGTCTTCATGCTCGTCTGGTTCGCCGCCCGCCACGTCCTCTACATC
ATGGTCTGCTGGTCCGTCTACGCGCACACGCCCAACATCATGCCCACCGGCTGCTTCACCGGCAGCGGAGCCCAC
CCGGCCGGGCCGGAGCCGACGCCGTCGGGCCTGTCGTACCTCATCGAGCCCTTCCTCAGCGCCAGCGGCCGCGTC
TGCTACAGCCAGACGGTCAAGTGGGCCTTTTTGGCCCCGCTCCTGCTCCTGCAGGTCATCACCATAATCTGGTTC
ACCATGATTGTCCGCATCGCCGTCAAGGTCATCCGCGGCGACGGCGCCGAGGACACGCGCAGCGACGACGAGGGC
GACGAGGAGGAGGAGGAAGAGGACGACGAGTTCGTCTACGAGGAGGCCCGGCCGCTTGAGGAGGAGGTGGGCGTC
GAGGACCTCGACCTCAAGGGCTGGGAGCGCCGGGCCGGGGTTAAGCGCCAGGCCAGCAGCTCGGGAGTGAGCCTG
CCGGGGCACAGCGACCGAAAGGAGCTGCTCGGCCGCATCGGCTGCGAGAAGCAGGTCGACTGA
Gene >Hirsu2|10769
ATGAGCGATTCGGAGCGCCGCGAGTCGTCGCCTCCCCTCGACAGGGCCGCCAAATCCGCCGCGCGCAAGACCAAC
ATGAACGGCCCGCTCTACATGCAGACCTCGGGCAGCAACGTCGTCCTCGTCCGCCGCCTGAAGCGCAGAGACGAC
GGCACCTGGAGGCACCTGGCCCGCTGGTTCGTCGAGAACCAGATCGGTTCGTCTCCCCTCCCACTCGACTCCCGA
CACGTCTGCCCTCTCCGCCTCTTGGCCCCATTGCCTCGGCTGTGAGCACGCGTCGAGGCCGTCGAGGTGCCCTGC
CGCCTGCCTTCCGCCCGTCCTTCTCTCTGTCTCTCTCCTTGTCTCTCTCCGTGTCTCTCCGTGTCTCTCTCGACC
CTTCACCCTCCCCCCCACCAGTCGTCGTTCAACGCTAACACTCTCCCTCAATCCGCAGGCCTGTCCTTCAACCTC
CTCGCCCTCCTCTTCCTCGCCCACAGCTTCATCCCCAAGGCCCGGATACATACCCACAAGTTCTTCCACCTGGCC
TACTACAACCCAGAGACGGACAAGTATGGCACCGGCATCGACGACGCATACTTCGTCGCCTTCTGCATCGTCCTC
TTCACCGGCCTGCGCGCCGGCACCATGGAACACATCCTCGCCCCCTTCGGCCGCCTCCAGGGCCTCGCCCGCCGC
AAGGTCTTGACGCGCTTCAGCGAGCAGGCCTGGCTGCTCATCTACTACAGCCTCTTCTGGACGCTCGGCATGGTA
CGTCGCCCGGCCCGCCGCGCCGGCGGGAGAGAGCGCTGACCCGAGGCAGTACATCTACTCGACCTCGCCCTACTT
CCTCAACATGCGCGAGCTCTGGACCGACTGGCCCAGCCGCGAGATGGACGGCCTGATGAAGGGCTACATCCTCGC
CCAGTGGGCCTTTTGGCTGCAGCAGATCATCGTCATCAACATCGAGGAGCGCCGCAAGGACCACTGGCAGATGTC
CAGCCACCACATCATCACCACCGCCCTCATCTCCTCGTGCTACTGCTACCACCACACCCGCGTCGGCAACTACAT
CCTCGTCATCATGGACGTCGTCGACCTGTTTCTGCCCGTAAGTCTCGCCCCGTCGTCGGCGGGAGCCGGCACGCT
GACCCTCTCCGCCGTAGCTGGCCAAGTGCCTCAAGTACGCCGACTACAACACGCTCTGCGACGTCGCCTTTGGCG
TCTTCATGCTCGTCTGGTTCGCCGCCCGCCACGTCCTCTACATCATGGTCTGCTGGTCCGTCTACGCGCACACGC
CCAACATCATGCCCACCGGCTGCTTCACCGGCAGCGGAGCCCACCCGGCCGGGCCGGAGCCGACGCCGTCGGGCC
TGTCGTACCTCATCGAGCCCTTCCTCAGCGCCAGCGGCCGCGTCTGCTACAGCCAGACGGTCAAGTGGGCCTTTT
TGGCCCCGCTCCTGCTCCTGCAGGTCATCACCATAATCTGGTTCACCATGATTGTCCGCATCGCCGTCAAGGTCA
TCCGCGGCGACGGCGCCGAGGACACGCGCAGCGACGACGAGGGCGACGAGGAGGAGGAGGAAGAGGACGACGAGT
TCGTCTACGAGGAGGCCCGGCCGCTTGAGGAGGAGGTGGGCGTCGAGGACCTCGACCTCAAGGGCTGGGAGCGCC
GGGCCGGGGTTAAGCGCCAGGCCAGCAGCTCGGGAGTGAGCCTGCCGGGGCACAGCGACCGAAAGGAGCTGCTCG
GCCGCATCGGCTGCGAGAAGCAGGTCGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail