Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10768
Gene name
LocationContig_90:55..397
Strand+
Gene length (bp)342
Transcript length (bp)342
Coding sequence length (bp)342
Protein length (aa) 114

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13193 AMP-binding_C AMP-binding enzyme C-terminal domain 3.5E-14 2 95

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 2 103 1.0E-10
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 2 107 1.0E-09
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 2 107 6.0E-09
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 2 105 7.0E-09
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 1 110 7.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 2 103 1.0E-10
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 2 107 1.0E-09
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 2 107 6.0E-09
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 2 105 7.0E-09
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 1 110 7.0E-09
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 2 111 5.0E-08
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 2 103 7.0E-08
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 2 103 1.0E-07
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 2 103 2.0E-07
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 2 103 2.0E-07
sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 2 109 1.0E-06
sp|Q3IFM6|ACSA_PSEHT Acetyl-coenzyme A synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=acsA PE=3 SV=1 2 106 2.0E-06
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 2 103 2.0E-06
sp|Q0HTY6|ACSA_SHESR Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-7) GN=acsA PE=3 SV=1 4 111 3.0E-06
sp|Q0HHN4|ACSA_SHESM Acetyl-coenzyme A synthetase OS=Shewanella sp. (strain MR-4) GN=acsA PE=3 SV=1 4 111 3.0E-06
sp|Q9Y7B5|ACS2_KLULA Acetyl-coenzyme A synthetase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS2 PE=3 SV=2 3 111 3.0E-06
sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 2 110 4.0E-06
sp|Q885K7|ACSA_PSESM Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=acsA PE=3 SV=1 2 110 4.0E-06
sp|B2U6V1|ACSA_RALPJ Acetyl-coenzyme A synthetase OS=Ralstonia pickettii (strain 12J) GN=acsA PE=3 SV=1 2 108 4.0E-06
sp|Q48G09|ACSA_PSE14 Acetyl-coenzyme A synthetase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=acsA PE=3 SV=1 2 110 4.0E-06
sp|A6WM52|ACSA_SHEB8 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS185) GN=acsA PE=3 SV=1 4 111 5.0E-06
sp|A3D3E8|ACSA_SHEB5 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=acsA PE=3 SV=1 4 111 5.0E-06
sp|A9KY56|ACSA_SHEB9 Acetyl-coenzyme A synthetase OS=Shewanella baltica (strain OS195) GN=acsA PE=3 SV=1 4 111 5.0E-06
sp|Q01574|ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS1 PE=1 SV=2 2 111 5.0E-06
sp|Q084J4|ACSA_SHEFN Acetyl-coenzyme A synthetase OS=Shewanella frigidimarina (strain NCIMB 400) GN=acsA PE=3 SV=1 4 111 5.0E-06
sp|Q39EK2|ACSA_BURL3 Acetyl-coenzyme A synthetase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=acsA PE=3 SV=1 4 108 6.0E-06
sp|Q6BS00|ACS2_DEBHA Acetyl-coenzyme A synthetase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS2 PE=3 SV=1 3 110 6.0E-06
sp|Q750T7|ACS2_ASHGO Acetyl-coenzyme A synthetase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS2 PE=3 SV=1 3 111 6.0E-06
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 3 103 9.0E-06
sp|Q2T3N9|ACSA_BURTA Acetyl-coenzyme A synthetase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=acsA PE=3 SV=1 4 108 9.0E-06
sp|Q63NC4|ACSA_BURPS Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain K96243) GN=acsA PE=3 SV=1 4 108 1.0E-05
sp|A3NH07|ACSA_BURP6 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 668) GN=acsA PE=3 SV=1 4 108 1.0E-05
sp|Q3JH62|ACSA_BURP1 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1710b) GN=acsA PE=3 SV=1 4 108 1.0E-05
sp|A3P2K7|ACSA_BURP0 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1106a) GN=acsA PE=3 SV=1 4 108 1.0E-05
sp|A1UWN5|ACSA_BURMS Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain SAVP1) GN=acsA PE=3 SV=1 4 108 1.0E-05
sp|Q62AD1|ACSA_BURMA Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain ATCC 23344) GN=acsA PE=3 SV=1 4 108 1.0E-05
sp|A2RYW5|ACSA_BURM9 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10229) GN=acsA PE=3 SV=1 4 108 1.0E-05
sp|A3MG40|ACSA_BURM7 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10247) GN=acsA PE=3 SV=1 4 108 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10768
LPGVHDVSVVGLPDDRLGETVAAFVVAARGWATADDERDDDDGNKSGGDGDKTADAAGTLTKAAVRDWVRARLAA
HLVPKHVFWLPDLPKTASGKIQKFKLREAAAADGDNGR*
Coding >Hirsu2|10768
CTGCCGGGCGTCCATGACGTCAGCGTCGTCGGCCTGCCGGACGACCGCCTCGGCGAGACCGTCGCCGCCTTTGTC
GTCGCCGCCCGCGGCTGGGCCACCGCCGATGACGAACGTGACGACGACGACGGCAACAAGAGCGGCGGCGACGGC
GACAAGACGGCCGATGCCGCCGGCACCCTGACCAAGGCCGCCGTCCGCGACTGGGTCCGCGCCCGTCTCGCCGCC
CACCTCGTCCCCAAGCACGTCTTCTGGCTGCCCGACCTGCCCAAGACGGCCAGCGGCAAGATCCAGAAGTTCAAG
CTGCGCGAGGCCGCCGCCGCCGACGGCGACAACGGCCGCTGA
Transcript >Hirsu2|10768
CTGCCGGGCGTCCATGACGTCAGCGTCGTCGGCCTGCCGGACGACCGCCTCGGCGAGACCGTCGCCGCCTTTGTC
GTCGCCGCCCGCGGCTGGGCCACCGCCGATGACGAACGTGACGACGACGACGGCAACAAGAGCGGCGGCGACGGC
GACAAGACGGCCGATGCCGCCGGCACCCTGACCAAGGCCGCCGTCCGCGACTGGGTCCGCGCCCGTCTCGCCGCC
CACCTCGTCCCCAAGCACGTCTTCTGGCTGCCCGACCTGCCCAAGACGGCCAGCGGCAAGATCCAGAAGTTCAAG
CTGCGCGAGGCCGCCGCCGCCGACGGCGACAACGGCCGCTGA
Gene >Hirsu2|10768
CTGCCGGGCGTCCATGACGTCAGCGTCGTCGGCCTGCCGGACGACCGCCTCGGCGAGACCGTCGCCGCCTTTGTC
GTCGCCGCCCGCGGCTGGGCCACCGCCGATGACGAACGTGACGACGACGACGGCAACAAGAGCGGCGGCGACGGC
GACAAGACGGCCGATGCCGCCGGCACCCTGACCAAGGCCGCCGTCCGCGACTGGGTCCGCGCCCGTCTCGCCGCC
CACCTCGTCCCCAAGCACGTCTTCTGGCTGCCCGACCTGCCCAAGACGGCCAGCGGCAAGATCCAGAAGTTCAAG
CTGCGCGAGGCCGCCGCCGCCGACGGCGACAACGGCCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail