Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10763
Gene name
LocationContig_9:68537..69566
Strand+
Gene length (bp)1029
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10369 ALS_ss_C Small subunit of acetolactate synthase 1.6E-12 238 296
PF01842 ACT ACT domain 3.9E-13 88 152
PF13710 ACT_5 ACT domain 2.1E-07 97 153

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25605|ILV6_YEAST Acetolactate synthase small subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV6 PE=1 SV=2 37 323 9.0E-123
sp|O60086|ILV6_SCHPO Probable acetolactate synthase small subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14C8.04 PE=1 SV=2 37 298 5.0E-79
sp|Q57625|ILVH_METJA Probable acetolactate synthase small subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvH PE=3 SV=1 87 298 5.0E-29
sp|O27492|ILVH_METTH Probable acetolactate synthase small subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ilvH PE=3 SV=1 85 297 1.0E-25
sp|O28555|ILVH_ARCFU Probable acetolactate synthase small subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ilvH PE=3 SV=1 87 297 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25605|ILV6_YEAST Acetolactate synthase small subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV6 PE=1 SV=2 37 323 9.0E-123
sp|O60086|ILV6_SCHPO Probable acetolactate synthase small subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14C8.04 PE=1 SV=2 37 298 5.0E-79
sp|Q57625|ILVH_METJA Probable acetolactate synthase small subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvH PE=3 SV=1 87 298 5.0E-29
sp|O27492|ILVH_METTH Probable acetolactate synthase small subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ilvH PE=3 SV=1 85 297 1.0E-25
sp|O28555|ILVH_ARCFU Probable acetolactate synthase small subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ilvH PE=3 SV=1 87 297 2.0E-24
sp|O67703|ILVH_AQUAE Acetolactate synthase small subunit OS=Aquifex aeolicus (strain VF5) GN=ilvH PE=3 SV=1 86 296 5.0E-24
sp|P9WKJ3|ILVH_MYCTU Putative acetolactate synthase small subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvH PE=1 SV=1 85 298 3.0E-23
sp|P9WKJ2|ILVH_MYCTO Putative acetolactate synthase small subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ilvH PE=3 SV=1 85 298 3.0E-23
sp|P65162|ILVH_MYCBO Acetolactate synthase small subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ilvH PE=3 SV=1 85 298 3.0E-23
sp|Q55141|ILVH_SYNY3 Acetolactate synthase small subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ilvH PE=3 SV=2 87 296 5.0E-21
sp|O33113|ILVH_MYCLE Acetolactate synthase small subunit OS=Mycobacterium leprae (strain TN) GN=ilvH PE=3 SV=1 88 298 8.0E-21
sp|Q9MS98|ILVH_GALSU Acetolactate synthase small subunit OS=Galdieria sulphuraria GN=ilvH PE=3 SV=1 87 296 1.0E-20
sp|Q9TLY1|ILVH_CYACA Acetolactate synthase small subunit OS=Cyanidium caldarium GN=ilvH PE=3 SV=1 87 297 6.0E-20
sp|P57320|ILVH_BUCAI Acetolactate synthase small subunit OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ilvH PE=3 SV=1 87 296 1.0E-19
sp|P51230|ILVH_PORPU Acetolactate synthase small subunit OS=Porphyra purpurea GN=ilvH PE=3 SV=1 87 297 2.0E-19
sp|Q1XDQ7|ILVH_PYRYE Acetolactate synthase small subunit OS=Pyropia yezoensis GN=ilvH PE=3 SV=1 87 297 5.0E-18
sp|P21622|ILVH_SALTY Acetolactate synthase isozyme 3 small subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ilvH PE=3 SV=2 87 198 3.0E-17
sp|Q59499|ILVH_MYCAV Acetolactate synthase small subunit OS=Mycobacterium avium GN=ilvH PE=3 SV=1 85 176 3.0E-17
sp|O78451|ILVH_GUITH Acetolactate synthase small subunit OS=Guillardia theta GN=ilvH PE=3 SV=1 87 296 7.0E-17
sp|P00894|ILVH_ECOLI Acetolactate synthase isozyme 3 small subunit OS=Escherichia coli (strain K12) GN=ilvH PE=1 SV=3 87 198 7.0E-17
sp|A0QUX7|ILVH_MYCS2 Acetolactate synthase small subunit OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ilvH PE=1 SV=1 88 176 8.0E-17
sp|P45260|ILVH_HAEIN Acetolactate synthase small subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ilvH PE=3 SV=1 87 180 4.0E-16
sp|Q89AP8|ILVH_BUCBP Acetolactate synthase small subunit OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ilvH PE=3 SV=1 86 183 4.0E-14
sp|O85294|ILVH_BUCAP Acetolactate synthase small subunit OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ilvH PE=3 SV=1 87 176 7.0E-14
sp|Q9SMC2|ILVH_NICPL Acetolactate synthase small subunit 1, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 82 178 8.0E-14
sp|Q9FFF4|ILVH1_ARATH Acetolactate synthase small subunit 1, chloroplastic OS=Arabidopsis thaliana GN=VAT1 PE=1 SV=1 86 177 1.0E-13
sp|Q93YZ7|ILVH2_ARATH Acetolactate synthase small subunit 2, chloroplastic OS=Arabidopsis thaliana GN=At2g31810 PE=1 SV=1 86 301 1.0E-12
sp|P37252|ILVH_BACSU Acetolactate synthase small subunit OS=Bacillus subtilis (strain 168) GN=ilvH PE=3 SV=3 87 176 3.0E-12
sp|Q9FFF4|ILVH1_ARATH Acetolactate synthase small subunit 1, chloroplastic OS=Arabidopsis thaliana GN=VAT1 PE=1 SV=1 86 176 4.0E-12
sp|Q93YZ7|ILVH2_ARATH Acetolactate synthase small subunit 2, chloroplastic OS=Arabidopsis thaliana GN=At2g31810 PE=1 SV=1 82 178 6.0E-12
sp|Q9SMC2|ILVH_NICPL Acetolactate synthase small subunit 1, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 90 188 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10763
MVSLRSCGAPLRRAAAASWSRPSSTSLGAVRWNSSGSSSTSAIAYKALRNRSAPLPVTNSPPSWSAQAAVSNILY
ETPTPTTTPPKRHILNCLVQNEPGVLSRLSGILAARGFNIDSLVVCNTEVEDLSRMTIVLTGQDGVVEQARRQLE
DLVPVWAVLDYSNAALVQRELLLAKINILGPEYFEELLAHHREITAGERERRPEAGDRPPQSLEESAQDFHPSKL
AASEALRHKHEHLKTITYFTHQFGGKVLDISTISCIVELSAKQTRIDSFLKLVAPFGILESARTGLMALPRSPLH
APSEEPISKEADDVVDISQLPPG*
Coding >Hirsu2|10763
ATGGTGTCGCTCCGGTCTTGCGGCGCGCCCCTTCGCCGGGCGGCGGCCGCCAGCTGGAGCCGCCCATCGAGTACC
TCGCTCGGAGCCGTCCGATGGAACTCGTCGGGCAGCAGCTCGACCTCTGCCATTGCCTACAAGGCTCTCCGGAAC
CGGTCCGCTCCTCTCCCCGTGACCAACTCGCCGCCGTCGTGGTCCGCGCAGGCCGCCGTGTCCAACATCCTGTAC
GAGACGCCGACGCCTACCACGACTCCCCCGAAGCGTCACATTCTCAACTGCCTGGTCCAGAATGAGCCGGGCGTC
CTGTCCCGCCTTTCTGGCATCCTCGCCGCCCGAGGCTTCAACATCGATTCTCTGGTCGTTTGCAACACCGAGGTC
GAGGACCTGTCCCGCATGACCATTGTGCTCACCGGCCAAGACGGCGTCGTCGAGCAGGCCCGCCGTCAGCTGGAG
GATCTGGTGCCCGTCTGGGCCGTCTTGGACTACAGTAACGCGGCCCTGGTCCAGCGCGAGCTCCTGCTCGCCAAG
ATTAACATCCTCGGGCCCGAGTATTTCGAGGAGCTTCTGGCTCACCACCGCGAGATCACAGCGGGAGAGCGCGAA
AGGCGCCCCGAGGCCGGCGACCGGCCGCCTCAGTCGCTCGAGGAGTCGGCCCAGGACTTTCACCCAAGCAAGCTC
GCCGCCAGTGAGGCCTTGCGGCACAAGCATGAGCATCTGAAGACCATCACCTACTTCACCCACCAGTTCGGGGGC
AAAGTTTTGGACATAAGCACCATCAGTTGCATTGTCGAGTTGTCTGCCAAACAAACCAGAATCGACTCTTTCCTG
AAGCTAGTCGCGCCCTTCGGCATCCTTGAGTCGGCTCGCACTGGCTTGATGGCACTCCCGCGATCACCCCTCCAC
GCCCCCAGTGAGGAACCTATCTCCAAGGAGGCGGATGATGTTGTCGATATCAGCCAGCTTCCTCCCGGTTAA
Transcript >Hirsu2|10763
ATGGTGTCGCTCCGGTCTTGCGGCGCGCCCCTTCGCCGGGCGGCGGCCGCCAGCTGGAGCCGCCCATCGAGTACC
TCGCTCGGAGCCGTCCGATGGAACTCGTCGGGCAGCAGCTCGACCTCTGCCATTGCCTACAAGGCTCTCCGGAAC
CGGTCCGCTCCTCTCCCCGTGACCAACTCGCCGCCGTCGTGGTCCGCGCAGGCCGCCGTGTCCAACATCCTGTAC
GAGACGCCGACGCCTACCACGACTCCCCCGAAGCGTCACATTCTCAACTGCCTGGTCCAGAATGAGCCGGGCGTC
CTGTCCCGCCTTTCTGGCATCCTCGCCGCCCGAGGCTTCAACATCGATTCTCTGGTCGTTTGCAACACCGAGGTC
GAGGACCTGTCCCGCATGACCATTGTGCTCACCGGCCAAGACGGCGTCGTCGAGCAGGCCCGCCGTCAGCTGGAG
GATCTGGTGCCCGTCTGGGCCGTCTTGGACTACAGTAACGCGGCCCTGGTCCAGCGCGAGCTCCTGCTCGCCAAG
ATTAACATCCTCGGGCCCGAGTATTTCGAGGAGCTTCTGGCTCACCACCGCGAGATCACAGCGGGAGAGCGCGAA
AGGCGCCCCGAGGCCGGCGACCGGCCGCCTCAGTCGCTCGAGGAGTCGGCCCAGGACTTTCACCCAAGCAAGCTC
GCCGCCAGTGAGGCCTTGCGGCACAAGCATGAGCATCTGAAGACCATCACCTACTTCACCCACCAGTTCGGGGGC
AAAGTTTTGGACATAAGCACCATCAGTTGCATTGTCGAGTTGTCTGCCAAACAAACCAGAATCGACTCTTTCCTG
AAGCTAGTCGCGCCCTTCGGCATCCTTGAGTCGGCTCGCACTGGCTTGATGGCACTCCCGCGATCACCCCTCCAC
GCCCCCAGTGAGGAACCTATCTCCAAGGAGGCGGATGATGTTGTCGATATCAGCCAGCTTCCTCCCGGTTAA
Gene >Hirsu2|10763
ATGGTGTCGCTCCGGTCTTGCGGCGCGCCCCTTCGCCGGGCGGCGGCCGCCAGCTGGAGCCGCCCATCGAGTACC
TCGCTCGGAGCCGTCCGATGGAACTCGTCGGGCAGCAGCTCGACCTCTGCCATTGCCTACAAGGCTCTCCGGAAC
CGGTCCGCTCCTCTCCCCGTGACCAACTCGCCGCCGTCGTGGTCCGCGCAGGCCGCCGTGTCCAACATCCTGTAC
GAGACGCCGACGCCTACCACGACTCCCCCGAAGCGTCACATTCTCAACTGCCTGGTCCAGAATGAGCCGGGCGTC
CTGTCCCGCCTTTCTGGCATCCTCGCCGCCCGAGGCTTCAACATCGATTCTCTGGTCGTTTGCAACACCGAGGTC
GAGGACCTGTCCCGCATGACCATTGTGCTCACCGGCCAAGACGGCGTCGTCGAGCAGGCCCGCCGTCAGCTGGAG
GATCTGGTGCCCGTCTGGGCCGTCTTGGACTACAGTAACGCGGCCCTGGTCCAGCGCGAGCTCCTGCTCGCCAAG
ATTAACATCCTCGGGCCCGAGTATTTCGAGGAGCTTCTGGCTCACCACCGCGAGATCACAGCGGGAGAGCGCGAA
AGGCGCCCCGAGGCCGGCGACCGGCCGCCTCAGTCGCTCGAGGAGTCGGCCCAGGACTTTCACCCAAGCAAGCTC
GCCGCCAGTGAGGCCTTGCGGCACAAGCATGAGCATCTGAAGACCATCACCTACTTCACCCACCAGTTCGGGGGC
AAAGTTTTGGACATAAGCACCATCAGTTGCATTGTCGAGTTGTAAGTCAAGAGTCTCATCAGATGCCGTCTGCGC
CGCCCAGGCTTACAATGTCCTAGGTCTGCCAAACAAACCAGAATCGACTCTTTCCTGAAGCTAGTCGCGCCCTTC
GGCATCCTTGAGTCGGCTCGCACTGGCTTGATGGCACTCCCGCGATCACCCCTCCACGCCCCCAGTGAGGAACCT
ATCTCCAAGGAGGCGGATGATGTTGTCGATATCAGCCAGCTTCCTCCCGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail