Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10752
Gene name
LocationContig_9:40870..42093
Strand-
Gene length (bp)1223
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02800 Gp_dh_C Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain 4.6E-70 157 314
PF00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain 4.5E-38 4 104

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00584|G3P_CLAP2 Glyceraldehyde-3-phosphate dehydrogenase OS=Claviceps purpurea (strain 20.1) GN=GPD-1 PE=3 SV=1 4 338 0.0E+00
sp|P35143|G3P_COLGL Glyceraldehyde-3-phosphate dehydrogenase OS=Colletotrichum gloeosporioides GN=GPDA PE=2 SV=1 1 338 0.0E+00
sp|Q8WZN0|G3P_SORMA Glyceraldehyde-3-phosphate dehydrogenase OS=Sordaria macrospora GN=GPD PE=3 SV=2 4 338 0.0E+00
sp|P54118|G3P_NEUCR Glyceraldehyde-3-phosphate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gpd-1 PE=2 SV=2 4 338 0.0E+00
sp|P54117|G3P_COLLN Glyceraldehyde-3-phosphate dehydrogenase OS=Colletotrichum lindemuthianum GN=GPDA PE=3 SV=1 1 338 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00584|G3P_CLAP2 Glyceraldehyde-3-phosphate dehydrogenase OS=Claviceps purpurea (strain 20.1) GN=GPD-1 PE=3 SV=1 4 338 0.0E+00
sp|P35143|G3P_COLGL Glyceraldehyde-3-phosphate dehydrogenase OS=Colletotrichum gloeosporioides GN=GPDA PE=2 SV=1 1 338 0.0E+00
sp|Q8WZN0|G3P_SORMA Glyceraldehyde-3-phosphate dehydrogenase OS=Sordaria macrospora GN=GPD PE=3 SV=2 4 338 0.0E+00
sp|P54118|G3P_NEUCR Glyceraldehyde-3-phosphate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gpd-1 PE=2 SV=2 4 338 0.0E+00
sp|P54117|G3P_COLLN Glyceraldehyde-3-phosphate dehydrogenase OS=Colletotrichum lindemuthianum GN=GPDA PE=3 SV=1 1 338 0.0E+00
sp|Q96US8|G3P_SCLSC Glyceraldehyde-3-phosphate dehydrogenase OS=Sclerotinia sclerotiorum GN=GPD PE=3 SV=1 1 335 0.0E+00
sp|P19089|G3P_CRYPA Glyceraldehyde-3-phosphate dehydrogenase OS=Cryphonectria parasitica PE=3 SV=1 4 335 0.0E+00
sp|Q9P8C0|G3P_PHANO Glyceraldehyde-3-phosphate dehydrogenase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=GPD1 PE=3 SV=1 4 335 0.0E+00
sp|P17730|G3P2_TRIKO Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Trichoderma koningii GN=gpd2 PE=1 SV=3 1 338 0.0E+00
sp|P32637|G3P_PODAS Glyceraldehyde-3-phosphate dehydrogenase OS=Podospora anserina GN=GPD PE=3 SV=1 4 336 0.0E+00
sp|P28844|G3P_COCLU Glyceraldehyde-3-phosphate dehydrogenase OS=Cochliobolus lunatus GN=GPD PE=3 SV=1 4 335 0.0E+00
sp|P29497|G3P_COCHE Glyceraldehyde-3-phosphate dehydrogenase OS=Cochliobolus heterostrophus GN=GPD1 PE=3 SV=1 4 335 0.0E+00
sp|P53430|G3P_MONPU Glyceraldehyde-3-phosphate dehydrogenase OS=Monascus purpureus GN=GPD1 PE=3 SV=3 1 336 0.0E+00
sp|Q00640|G3P_BLUGH Glyceraldehyde-3-phosphate dehydrogenase OS=Blumeria graminis f. sp. hordei GN=GPD PE=3 SV=1 1 338 0.0E+00
sp|Q9HFX1|G3P_AJECA Glyceraldehyde-3-phosphate dehydrogenase OS=Ajellomyces capsulatus GN=GPD PE=2 SV=1 4 338 0.0E+00
sp|Q12552|G3P_ASPNG Glyceraldehyde-3-phosphate dehydrogenase OS=Aspergillus niger GN=gpdA PE=3 SV=2 1 336 0.0E+00
sp|Q1DTF9|G3P_COCIM Glyceraldehyde-3-phosphate dehydrogenase OS=Coccidioides immitis (strain RS) GN=GPD PE=3 SV=1 4 338 0.0E+00
sp|P87197|G3P_HYPAT Glyceraldehyde-3-phosphate dehydrogenase OS=Hypocrea atroviridis GN=gpd1 PE=2 SV=1 4 339 0.0E+00
sp|Q8J1H3|G3P_COCP7 Glyceraldehyde-3-phosphate dehydrogenase OS=Coccidioides posadasii (strain C735) GN=GPD PE=3 SV=1 4 338 0.0E+00
sp|Q8X1X3|G3P_PARBA Glyceraldehyde-3-phosphate dehydrogenase OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=GPD PE=1 SV=1 4 338 0.0E+00
sp|P17729|G3P1_TRIKO Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Trichoderma koningii GN=gpd1 PE=1 SV=3 1 338 0.0E+00
sp|P20445|G3P_EMENI Glyceraldehyde-3-phosphate dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gpdA PE=1 SV=2 1 336 0.0E+00
sp|Q9HGY7|G3P_ASPOR Glyceraldehyde-3-phosphate dehydrogenase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpdA PE=2 SV=1 1 335 0.0E+00
sp|P09317|G3P_USTMA Glyceraldehyde-3-phosphate dehydrogenase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=GAPD PE=3 SV=2 1 336 6.0E-180
sp|P0CN74|G3P_CRYNJ Glyceraldehyde-3-phosphate dehydrogenase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=GPD PE=3 SV=1 4 336 2.0E-177
sp|P0CN75|G3P_CRYNB Glyceraldehyde-3-phosphate dehydrogenase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=GPD PE=3 SV=1 4 336 2.0E-177
sp|Q9SAJ6|G3PP1_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPCP1, chloroplastic OS=Arabidopsis thaliana GN=GAPCP1 PE=1 SV=1 5 336 2.0E-176
sp|P32636|G3P2_AGABI Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Agaricus bisporus GN=gpd2 PE=3 SV=1 4 336 4.0E-175
sp|Q6CCU7|G3P_YARLI Glyceraldehyde-3-phosphate dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPD PE=3 SV=1 4 336 9.0E-173
sp|Q5E924|G3PP2_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPCP2, chloroplastic OS=Arabidopsis thaliana GN=GAPCP2 PE=2 SV=1 5 338 9.0E-173
sp|Q9UR38|G3P_LENED Glyceraldehyde-3-phosphate dehydrogenase OS=Lentinula edodes GN=gpd PE=2 SV=1 4 335 2.0E-172
sp|O13507|G3P_PHARH Glyceraldehyde-3-phosphate dehydrogenase OS=Phaffia rhodozyma GN=GPD PE=3 SV=1 4 336 1.0E-171
sp|O57479|G3P_COLLI Glyceraldehyde-3-phosphate dehydrogenase OS=Columba livia GN=GAPDH PE=2 SV=3 4 332 5.0E-171
sp|P48812|G3P_BRUMA Glyceraldehyde-3-phosphate dehydrogenase OS=Brugia malayi GN=G3PD PE=1 SV=1 1 332 6.0E-171
sp|Q05025|G3P_COTJA Glyceraldehyde-3-phosphate dehydrogenase OS=Coturnix coturnix japonica GN=GAPDH PE=2 SV=2 4 332 2.0E-170
sp|P07487|G3P2_DROME Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Drosophila melanogaster GN=Gapdh2 PE=1 SV=2 5 335 4.0E-170
sp|Q8NK47|G3P_RHIMI Glyceraldehyde-3-phosphate dehydrogenase OS=Rhizomucor miehei GN=GPD PE=3 SV=1 4 335 5.0E-170
sp|P20287|G3P_SCHMA Glyceraldehyde-3-phosphate dehydrogenase OS=Schistosoma mansoni PE=2 SV=1 1 335 1.0E-169
sp|Q5RAB4|G3P_PONAB Glyceraldehyde-3-phosphate dehydrogenase OS=Pongo abelii GN=GAPDH PE=2 SV=3 1 332 2.0E-169
sp|P16858|G3P_MOUSE Glyceraldehyde-3-phosphate dehydrogenase OS=Mus musculus GN=Gapdh PE=1 SV=2 4 332 2.0E-169
sp|P00356|G3P_CHICK Glyceraldehyde-3-phosphate dehydrogenase OS=Gallus gallus GN=GAPDH PE=2 SV=3 4 332 2.0E-169
sp|P04797|G3P_RAT Glyceraldehyde-3-phosphate dehydrogenase OS=Rattus norvegicus GN=Gapdh PE=1 SV=3 4 332 6.0E-169
sp|P17244|G3P_CRIGR Glyceraldehyde-3-phosphate dehydrogenase OS=Cricetulus griseus GN=GAPDH PE=2 SV=2 4 332 7.0E-169
sp|O44104|G3P2_DROPS Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Drosophila pseudoobscura pseudoobscura GN=Gapdh2 PE=2 SV=2 5 335 7.0E-169
sp|Q9Y796|G3P_CRYCU Glyceraldehyde-3-phosphate dehydrogenase OS=Cryptococcus curvatus GN=GPD PE=3 SV=1 5 335 7.0E-169
sp|P78958|G3P1_SCHPO Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tdh1 PE=1 SV=1 1 335 1.0E-168
sp|P04406|G3P_HUMAN Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens GN=GAPDH PE=1 SV=3 1 332 1.0E-168
sp|Q5R2J2|G3P_PELSI Glyceraldehyde-3-phosphate dehydrogenase OS=Pelodiscus sinensis GN=GAPDH PE=2 SV=1 4 332 2.0E-168
sp|O01360|G3P_ONCVO Glyceraldehyde-3-phosphate dehydrogenase OS=Onchocerca volvulus PE=2 SV=1 1 332 4.0E-168
sp|Q5XJ10|G3P_DANRE Glyceraldehyde-3-phosphate dehydrogenase OS=Danio rerio GN=gapdh PE=2 SV=2 4 332 5.0E-168
sp|Q28259|G3P_CANLF Glyceraldehyde-3-phosphate dehydrogenase OS=Canis lupus familiaris GN=GAPDH PE=2 SV=3 4 332 6.0E-168
sp|A3FKF7|G3P_MUSPF Glyceraldehyde-3-phosphate dehydrogenase OS=Mustela putorius furo GN=GAPDH PE=2 SV=1 4 332 8.0E-168
sp|P07486|G3P1_DROME Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Drosophila melanogaster GN=Gapdh1 PE=2 SV=2 5 335 8.0E-168
sp|Q4U3L0|G3P_GLOMM Glyceraldehyde-3-phosphate dehydrogenase OS=Glossina morsitans morsitans GN=Gapdh PE=2 SV=1 5 336 1.0E-167
sp|Q9N2D5|G3P_FELCA Glyceraldehyde-3-phosphate dehydrogenase OS=Felis catus GN=GAPDH PE=2 SV=3 4 332 1.0E-167
sp|Q09054|G3PC2_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic OS=Zea mays GN=GAPC2 PE=2 SV=1 1 333 2.0E-167
sp|Q4KYY3|G3P_SPECI Glyceraldehyde-3-phosphate dehydrogenase OS=Spermophilus citellus GN=GAPDH PE=2 SV=3 4 332 2.0E-167
sp|O43026|G3P2_SCHPO Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpd3 PE=1 SV=1 1 335 4.0E-167
sp|Q8TFJ2|G3P_OMPOL Glyceraldehyde-3-phosphate dehydrogenase OS=Omphalotus olearius GN=GPD PE=3 SV=1 4 335 6.0E-167
sp|P46406|G3P_RABIT Glyceraldehyde-3-phosphate dehydrogenase OS=Oryctolagus cuniculus GN=GAPDH PE=1 SV=3 4 332 1.0E-166
sp|P08735|G3PC1_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Zea mays GN=GAPC1 PE=2 SV=2 1 333 1.0E-166
sp|Q92211|G3P_CANAW Glyceraldehyde-3-phosphate dehydrogenase OS=Candida albicans (strain WO-1) GN=TDH1 PE=3 SV=2 4 336 1.0E-166
sp|P10096|G3P_BOVIN Glyceraldehyde-3-phosphate dehydrogenase OS=Bos taurus GN=GAPDH PE=1 SV=4 4 332 2.0E-166
sp|Q01597|G3P_DROHY Glyceraldehyde-3-phosphate dehydrogenase OS=Drosophila hydei GN=Gapdh1 PE=3 SV=1 5 335 3.0E-166
sp|Q42671|G3PC_CRAPL Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Craterostigma plantagineum GN=GAPC PE=2 SV=1 1 332 5.0E-166
sp|Q6BMK0|G3P_DEBHA Glyceraldehyde-3-phosphate dehydrogenase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GPD PE=3 SV=1 4 333 6.0E-166
sp|A2YQT7|G3PC_ORYSI Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Oryza sativa subsp. indica GN=GAPC PE=2 SV=1 1 333 9.0E-166
sp|Q0J8A4|G3PC1_ORYSJ Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Oryza sativa subsp. japonica GN=GAPC1 PE=1 SV=1 1 333 9.0E-166
sp|P00355|G3P_PIG Glyceraldehyde-3-phosphate dehydrogenase OS=Sus scrofa GN=GAPDH PE=1 SV=4 4 332 1.0E-165
sp|P56649|G3P_PANVR Glyceraldehyde-3-phosphate dehydrogenase OS=Panulirus versicolor PE=1 SV=1 5 336 4.0E-165
sp|P25861|G3PC_ANTMA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Antirrhinum majus GN=GAPC PE=2 SV=1 1 334 6.0E-165
sp|P34921|G3PC_DIACA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Dianthus caryophyllus GN=GAPC PE=3 SV=1 1 333 7.0E-165
sp|P51469|G3P_XENLA Glyceraldehyde-3-phosphate dehydrogenase OS=Xenopus laevis GN=gapdh PE=2 SV=2 4 332 7.0E-165
sp|Q01982|G3P_PHACH Glyceraldehyde-3-phosphate dehydrogenase OS=Phanerochaete chrysosporium GN=GPD PE=3 SV=1 3 335 1.0E-164
sp|Q92243|G3P_LYOSH Glyceraldehyde-3-phosphate dehydrogenase OS=Lyophyllum shimeji GN=GPD PE=3 SV=1 4 339 1.0E-164
sp|Q7FAH2|G3PC2_ORYSJ Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic OS=Oryza sativa subsp. japonica GN=GAPC2 PE=1 SV=1 1 331 1.0E-164
sp|P34922|G3PC_PEA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Pisum sativum GN=GAPC1 PE=2 SV=1 2 333 1.0E-164
sp|Q94469|G3P_DICDI Glyceraldehyde-3-phosphate dehydrogenase OS=Dictyostelium discoideum GN=gpdA PE=1 SV=2 4 333 4.0E-164
sp|Q43247|G3PC3_MAIZE Glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic OS=Zea mays GN=GAPC3 PE=2 SV=1 1 331 4.0E-164
sp|P32810|G3P3_CAEBR Glyceraldehyde-3-phosphate dehydrogenase 3.1 OS=Caenorhabditis briggsae GN=gpd-3.1 PE=3 SV=1 1 332 9.0E-164
sp|P00357|G3P_HOMAM Glyceraldehyde-3-phosphate dehydrogenase OS=Homarus americanus PE=1 SV=2 5 336 1.0E-163
sp|P34923|G3PC_PHYPA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Physcomitrella patens subsp. patens GN=GAPC PE=2 SV=1 2 333 4.0E-163
sp|Q6K5G8|G3PC3_ORYSJ Glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic OS=Oryza sativa subsp. japonica GN=GAPC3 PE=2 SV=1 1 331 6.0E-163
sp|P17330|G3P3_CAEEL Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Caenorhabditis elegans GN=gpd-3 PE=3 SV=1 1 332 1.0E-162
sp|P17329|G3P2_CAEEL Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Caenorhabditis elegans GN=gpd-2 PE=3 SV=2 1 332 1.0E-162
sp|P26517|G3PC1_HORVU Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic OS=Hordeum vulgare GN=GAPC PE=2 SV=1 1 333 1.0E-162
sp|P04970|G3P1_CAEEL Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Caenorhabditis elegans GN=gpd-1 PE=3 SV=1 1 332 2.0E-162
sp|P17331|G3P4_CAEEL Glyceraldehyde-3-phosphate dehydrogenase 4 OS=Caenorhabditis elegans GN=gpd-4 PE=3 SV=1 1 332 5.0E-162
sp|P32638|G3P_SCHCO Glyceraldehyde-3-phosphate dehydrogenase OS=Schizophyllum commune GN=GPD PE=3 SV=1 4 335 5.0E-162
sp|P26518|G3PC_MAGLI Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Magnolia liliiflora GN=GAPC PE=2 SV=1 4 331 1.0E-161
sp|P32809|G3P2_CAEBR Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Caenorhabditis briggsae GN=gpd-2 PE=3 SV=1 1 332 1.0E-161
sp|Q96UF2|G3P2_MUCCL Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Mucor circinelloides f. lusitanicus GN=GPD2 PE=3 SV=1 5 328 2.0E-161
sp|P26519|G3PC_PETCR Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petroselinum crispum GN=GAPC PE=2 SV=1 4 334 3.0E-161
sp|P34783|G3P_ATRNU Glyceraldehyde-3-phosphate dehydrogenase OS=Atriplex nummularia PE=2 SV=1 1 333 4.0E-161
sp|P25858|G3PC1_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic OS=Arabidopsis thaliana GN=GAPC1 PE=1 SV=2 4 333 6.0E-161
sp|P04796|G3PC_SINAL Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Sinapis alba GN=GAPC PE=2 SV=2 4 333 2.0E-160
sp|Q9UVC0|G3P_WICCF Glyceraldehyde-3-phosphate dehydrogenase OS=Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) GN=GPD PE=3 SV=2 4 332 3.0E-160
sp|P26520|G3PC_PETHY Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petunia hybrida GN=GAPC PE=2 SV=1 1 335 4.0E-160
sp|Q9C136|G3P1_MUCCL Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Mucor circinelloides f. lusitanicus GN=GPD1 PE=2 SV=1 4 335 5.0E-160
sp|P17878|G3PC_MESCR Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Mesembryanthemum crystallinum GN=GAPC PE=2 SV=1 1 333 6.0E-160
sp|Q9FX54|G3PC2_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPC2, cytosolic OS=Arabidopsis thaliana GN=GAPC2 PE=1 SV=1 4 333 1.0E-159
sp|P80534|G3P_JACOR Glyceraldehyde-3-phosphate dehydrogenase, muscle OS=Jaculus orientalis PE=1 SV=2 4 332 1.0E-159
sp|P17819|G3P1_KLULA Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAP1 PE=1 SV=1 4 332 2.0E-159
sp|Q28554|G3P_SHEEP Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Ovis aries GN=GAPDH PE=2 SV=4 14 332 2.0E-159
sp|Q96UF1|G3P3_MUCCL Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Mucor circinelloides f. lusitanicus GN=GPD3 PE=3 SV=1 1 335 4.0E-159
sp|Q39769|G3PC_GINBI Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ginkgo biloba PE=2 SV=1 4 332 5.0E-159
sp|O59841|G3P_OGAPD Glyceraldehyde-3-phosphate dehydrogenase OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=GPD PE=3 SV=2 6 336 1.0E-157
sp|Q41595|G3PC_TAXBA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Taxus baccata PE=2 SV=1 4 331 2.0E-157
sp|Q92263|G3P_PICPA Glyceraldehyde-3-phosphate dehydrogenase OS=Komagataella pastoris GN=GPD PE=3 SV=1 4 333 2.0E-157
sp|P26521|G3PC_RANAC Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ranunculus acris GN=GAPC PE=2 SV=1 4 333 3.0E-157
sp|P54270|G3PC_GRAGA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Gracilaria gracilis GN=GAPC PE=3 SV=1 1 334 4.0E-157
sp|P34924|G3PC_PINSY Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Pinus sylvestris GN=GAPC PE=2 SV=1 4 332 5.0E-157
sp|Q64467|G3PT_MOUSE Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Mus musculus GN=Gapdhs PE=1 SV=1 4 331 7.0E-157
sp|Q757I2|G3P_ASHGO Glyceraldehyde-3-phosphate dehydrogenase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPD PE=3 SV=2 4 332 2.0E-156
sp|P84998|G3P1_KLUMA Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Kluyveromyces marxianus GN=GAP1 PE=1 SV=1 4 332 2.0E-156
sp|Q5MJ86|G3P2_DANRE Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Danio rerio GN=gapdh-2 PE=2 SV=1 1 331 4.0E-156
sp|P09094|G3PC_TOBAC Glyceraldehyde-3-phosphate dehydrogenase, cytosolic (Fragment) OS=Nicotiana tabacum GN=GAPC PE=2 SV=1 12 334 4.0E-156
sp|P08439|G3P_ZYGRO Glyceraldehyde-3-phosphate dehydrogenase OS=Zygosaccharomyces rouxii PE=3 SV=1 4 333 7.0E-156
sp|P0A1P0|G3P_SALTY Glyceraldehyde-3-phosphate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gapA PE=3 SV=2 4 333 8.0E-156
sp|P0A1P1|G3P_SALTI Glyceraldehyde-3-phosphate dehydrogenase OS=Salmonella typhi GN=gapA PE=3 SV=2 4 333 8.0E-156
sp|P00360|G3P1_YEAST Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDH1 PE=1 SV=3 4 333 9.0E-156
sp|Q9ESV6|G3PT_RAT Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Rattus norvegicus GN=Gapdhs PE=1 SV=1 4 331 9.0E-156
sp|P10097|G3PC_TRYBB Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Trypanosoma brucei brucei PE=1 SV=3 4 333 1.0E-155
sp|O44105|G3P2_DROSU Glyceraldehyde-3-phosphate dehydrogenase 2 (Fragment) OS=Drosophila subobscura GN=Gapdh2 PE=2 SV=1 13 317 7.0E-155
sp|I2BA89|G3P_SHIBC Glyceraldehyde-3-phosphate dehydrogenase OS=Shimwellia blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 105725 / CDC 9005-74) GN=gapA PE=3 SV=1 4 333 2.0E-154
sp|P34920|G3PC_CHOCR Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Chondrus crispus GN=GAPC PE=2 SV=1 1 334 2.0E-154
sp|P51640|G3P_MESAU Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Mesocricetus auratus GN=GAPDH PE=2 SV=1 13 324 2.0E-154
sp|P0A9B5|G3P_SHIFL Glyceraldehyde-3-phosphate dehydrogenase OS=Shigella flexneri GN=gapA PE=3 SV=2 4 333 3.0E-154
sp|P0A9B3|G3P_ECOL6 Glyceraldehyde-3-phosphate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gapA PE=3 SV=2 4 333 3.0E-154
sp|P0A9B2|G3P1_ECOLI Glyceraldehyde-3-phosphate dehydrogenase A OS=Escherichia coli (strain K12) GN=gapA PE=1 SV=2 4 333 3.0E-154
sp|P0A9B4|G3P1_ECO57 Glyceraldehyde-3-phosphate dehydrogenase A OS=Escherichia coli O157:H7 GN=gapA PE=3 SV=2 4 333 3.0E-154
sp|B7LQ20|G3P_ESCF3 Glyceraldehyde-3-phosphate dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gapA PE=3 SV=1 4 333 4.0E-154
sp|P26988|G3P_PHYIN Glyceraldehyde-3-phosphate dehydrogenase OS=Phytophthora infestans GN=GPDA PE=3 SV=1 4 333 7.0E-154
sp|O14556|G3PT_HUMAN Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Homo sapiens GN=GAPDHS PE=1 SV=2 4 335 2.0E-153
sp|Q27652|G3P_ECHMU Glyceraldehyde-3-phosphate dehydrogenase OS=Echinococcus multilocularis PE=2 SV=1 1 335 2.0E-153
sp|O42259|G3P_ONCMY Glyceraldehyde-3-phosphate dehydrogenase OS=Oncorhynchus mykiss GN=gapdh PE=2 SV=1 1 331 7.0E-153
sp|P00359|G3P3_YEAST Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDH3 PE=1 SV=3 4 333 1.0E-152
sp|Q9UW96|G3P_PLESA Glyceraldehyde-3-phosphate dehydrogenase OS=Pleurotus sajor-caju GN=GPD PE=2 SV=1 4 338 2.0E-152
sp|Q01077|G3P2_KLUMA Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Kluyveromyces marxianus GN=GAP2 PE=3 SV=2 4 333 5.0E-152
sp|P84999|G3P3_KLUMA Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Kluyveromyces marxianus GN=GAP3 PE=1 SV=1 4 333 8.0E-152
sp|Q6CX23|G3P2_KLULA Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAP2 PE=3 SV=1 4 333 1.0E-151
sp|Q6FSM4|G3P2_CANGA Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPD2 PE=3 SV=1 4 333 4.0E-151
sp|O16027|G3P1_GLORO Glyceraldehyde-3-phosphate dehydrogenase 1 (Fragment) OS=Globodera rostochiensis GN=GPD-1 PE=2 SV=1 1 318 4.0E-151
sp|P00358|G3P2_YEAST Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDH2 PE=1 SV=3 4 333 4.0E-151
sp|Q6FPW3|G3P1_CANGA Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPD1 PE=3 SV=1 4 333 5.0E-151
sp|Q8VXQ8|G3PC_SCEVA Glyceraldehyde-3-phosphate dehydrogenase, cytosolic (Fragment) OS=Scenedesmus vacuolatus GN=GapC PE=2 SV=1 9 319 1.0E-149
sp|P49644|G3PC_CHLRE Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Chlamydomonas reinhardtii GN=GAPC PE=3 SV=1 4 333 2.0E-149
sp|Q59199|G3P_BACFR Glyceraldehyde-3-phosphate dehydrogenase OS=Bacteroides fragilis (strain YCH46) GN=gap PE=3 SV=2 4 332 7.0E-149
sp|Q2KJE5|G3PT_BOVIN Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Bos taurus GN=GAPDHS PE=2 SV=1 6 335 3.0E-147
sp|Q4R3T1|G3PT_MACFA Glyceraldehyde-3-phosphate dehydrogenase, testis-specific OS=Macaca fascicularis GN=GAPDHS PE=2 SV=1 4 335 4.0E-147
sp|P32635|G3P1_AGABI Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Agaricus bisporus GN=gpd1 PE=3 SV=1 4 333 2.0E-146
sp|P08477|G3PC2_HORVU Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic (Fragment) OS=Hordeum vulgare GN=GAPC PE=2 SV=1 33 331 5.0E-145
sp|Q01558|G3PC_LEIME Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Leishmania mexicana GN=GAPC PE=3 SV=3 4 330 2.0E-144
sp|P44304|G3P_HAEIN Glyceraldehyde-3-phosphate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gapA PE=3 SV=1 4 331 4.0E-143
sp|P52694|G3P_RALSO Glyceraldehyde-3-phosphate dehydrogenase OS=Ralstonia solanacearum (strain GMI1000) GN=gapA PE=3 SV=2 4 333 1.0E-142
sp|Q89AK1|G3P_BUCBP Glyceraldehyde-3-phosphate dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=gapA PE=3 SV=1 4 332 8.0E-141
sp|P55070|G3P_LACDT Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Lactarius deterrimus GN=GPD PE=3 SV=1 27 312 1.0E-140
sp|P24164|G3P_KLEPN Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Klebsiella pneumoniae GN=gap PE=3 SV=2 8 311 2.0E-139
sp|Q9N655|G3P_MASBA Glyceraldehyde-3-phosphate dehydrogenase OS=Mastigamoeba balamuthi GN=GAPD PE=2 SV=1 5 326 6.0E-138
sp|Q07234|G3P_BUCAP Glyceraldehyde-3-phosphate dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=gapA PE=3 SV=2 4 332 8.0E-138
sp|P34916|G3P1_ANAVT Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gap1 PE=3 SV=4 1 328 8.0E-138
sp|P80506|G3P1_NOSS1 Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gap1 PE=1 SV=3 1 333 3.0E-137
sp|P49433|G3P1_SYNY3 Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gap1 PE=3 SV=1 4 335 4.0E-135
sp|P57384|G3P_BUCAI Glyceraldehyde-3-phosphate dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gapA PE=3 SV=1 4 333 3.0E-134
sp|P24753|G3P_SEROD Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Serratia odorifera GN=gap PE=3 SV=1 17 311 7.0E-134
sp|P24748|G3P_CITFR Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Citrobacter freundii GN=gap PE=3 SV=1 17 311 4.0E-133
sp|P24751|G3P_ESCVU Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Escherichia vulneris GN=gap PE=3 SV=1 17 311 1.0E-132
sp|P55071|G3P_AMAMU Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Amanita muscaria GN=GPD PE=3 SV=1 25 312 1.0E-132
sp|P53429|G3P1_GIAIN Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Giardia intestinalis GN=GAP1 PE=3 SV=1 3 331 1.0E-132
sp|P24163|G3P_ENTAE Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Enterobacter aerogenes GN=gap PE=3 SV=1 17 311 1.0E-131
sp|P24750|G3P_ESCHE Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Escherichia hermannii GN=gap PE=3 SV=1 17 311 2.0E-131
sp|P0DJO7|G3P_SHIBL Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Shimwellia blattae GN=gap PE=3 SV=1 17 311 4.0E-131
sp|P0C8Z1|G3P_ESCFE Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Escherichia fergusonii GN=gapA PE=3 SV=1 17 311 9.0E-131
sp|P24166|G3P_SERMA Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Serratia marcescens GN=gap PE=3 SV=1 17 311 1.0E-130
sp|Q00301|G3P_BOLED Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Boletus edulis GN=GPD PE=3 SV=1 23 312 5.0E-129
sp|Q9Z7T0|G3P_CHLPN Glyceraldehyde-3-phosphate dehydrogenase OS=Chlamydia pneumoniae GN=gap PE=3 SV=1 4 333 2.0E-128
sp|O09452|G3PA_GUITH Glyceraldehyde-3-phosphate dehydrogenase, chloroplastic OS=Guillardia theta GN=GAPC1 PE=2 SV=1 1 339 4.0E-128
sp|B0B879|G3P_CHLT2 Glyceraldehyde-3-phosphate dehydrogenase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=gap PE=3 SV=1 4 333 2.0E-126
sp|P0CE13|G3P_CHLTR Glyceraldehyde-3-phosphate dehydrogenase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gap PE=3 SV=1 4 333 3.0E-125
sp|Q9PJN6|G3P_CHLMU Glyceraldehyde-3-phosphate dehydrogenase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gap PE=3 SV=1 4 331 9.0E-125
sp|P00362|G3P_GEOSE Glyceraldehyde-3-phosphate dehydrogenase OS=Geobacillus stearothermophilus GN=gap PE=1 SV=5 4 332 9.0E-125
sp|P09124|G3P1_BACSU Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Bacillus subtilis (strain 168) GN=gapA PE=1 SV=2 4 333 4.0E-124
sp|P23722|G3P_BACMD Glyceraldehyde-3-phosphate dehydrogenase OS=Bacillus megaterium (strain DSM 319) GN=gap PE=3 SV=3 4 332 5.0E-123
sp|P22512|G3PG_TRYBB Glyceraldehyde-3-phosphate dehydrogenase, glycosomal OS=Trypanosoma brucei brucei PE=1 SV=3 4 339 1.0E-122
sp|O57672|G3P_MELGA Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Meleagris gallopavo GN=GAPDH PE=2 SV=1 92 324 3.0E-122
sp|O96423|G3PG_CRIFA Glyceraldehyde-3-phosphate dehydrogenase, glycosomal OS=Crithidia fasciculata GN=GAPDG PE=3 SV=3 1 335 8.0E-121
sp|P22513|G3PG_TRYCR Glyceraldehyde-3-phosphate dehydrogenase, glycosomal OS=Trypanosoma cruzi PE=1 SV=1 3 335 1.0E-120
sp|Q27890|G3PG_LEIME Glyceraldehyde-3-phosphate dehydrogenase, glycosomal OS=Leishmania mexicana GN=GAPG PE=1 SV=3 1 336 5.0E-120
sp|Q4MQ58|G3P1_BACCE Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Bacillus cereus GN=gap1 PE=1 SV=3 5 331 2.0E-118
sp|A0QWW2|G3P_MYCS2 Glyceraldehyde-3-phosphate dehydrogenase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=gapA PE=1 SV=1 4 333 1.0E-112
sp|O83816|G3P_TREPA Glyceraldehyde-3-phosphate dehydrogenase OS=Treponema pallidum (strain Nichols) GN=gap PE=3 SV=1 4 333 2.0E-112
sp|P94915|G3P_MYCAV Glyceraldehyde-3-phosphate dehydrogenase OS=Mycobacterium avium GN=gapA PE=3 SV=3 4 333 3.0E-111
sp|P46713|G3P_MYCLE Glyceraldehyde-3-phosphate dehydrogenase OS=Mycobacterium leprae (strain TN) GN=gapA PE=3 SV=1 4 333 2.0E-109
sp|P9WN83|G3P_MYCTU Glyceraldehyde-3-phosphate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gap PE=1 SV=1 4 333 4.0E-109
sp|P9WN82|G3P_MYCTO Glyceraldehyde-3-phosphate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gap PE=3 SV=1 4 333 4.0E-109
sp|P64179|G3P_MYCBO Glyceraldehyde-3-phosphate dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gap PE=3 SV=1 4 333 4.0E-109
sp|P17721|G3P_THEMA Glyceraldehyde-3-phosphate dehydrogenase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gap PE=1 SV=2 5 334 6.0E-109
sp|O67161|G3P_AQUAE Glyceraldehyde-3-phosphate dehydrogenase OS=Aquifex aeolicus (strain VF5) GN=gap PE=1 SV=1 4 333 3.0E-106
sp|O34425|G3P2_BACSU Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=gapB PE=1 SV=1 4 332 2.0E-104
sp|P15115|G3P_BACCO Glyceraldehyde-3-phosphate dehydrogenase OS=Bacillus coagulans GN=gap PE=1 SV=2 4 331 8.0E-103
sp|Q829W3|G3P2_STRAW Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gap2 PE=1 SV=1 4 331 8.0E-103
sp|Q59309|G3P_CLOPA Glyceraldehyde-3-phosphate dehydrogenase OS=Clostridium pasteurianum GN=gap PE=1 SV=1 5 334 2.0E-102
sp|P34917|G3P2_ANAVT Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gap2 PE=3 SV=2 4 333 1.0E-101
sp|P58554|G3P2_NOSS1 Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gap2 PE=1 SV=1 4 333 4.0E-101
sp|P58072|G3P2_ECO57 Glyceraldehyde-3-phosphate dehydrogenase C OS=Escherichia coli O157:H7 GN=gapC PE=3 SV=1 5 334 1.0E-100
sp|E3VWI2|G3P2_STRAE Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Streptomyces arenae GN=gap2 PE=1 SV=1 4 331 3.0E-100
sp|P00361|G3P_THEAQ Glyceraldehyde-3-phosphate dehydrogenase OS=Thermus aquaticus GN=gap PE=1 SV=2 4 333 4.0E-100
sp|Q9Z518|G3P_STRCO Glyceraldehyde-3-phosphate dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gap PE=3 SV=1 4 331 4.0E-100
sp|P33898|G3P2_ECOLI Putative glyceraldehyde-3-phosphate dehydrogenase C OS=Escherichia coli (strain K12) GN=gapC PE=5 SV=2 5 334 2.0E-99
sp|O52631|G3P_CLOAB Glyceraldehyde-3-phosphate dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=gap PE=1 SV=1 5 334 3.0E-99
sp|P54226|G3P1_STRAE Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Streptomyces arenae GN=gap1 PE=1 SV=1 4 331 4.0E-99
sp|P46795|G3P_BORBU Glyceraldehyde-3-phosphate dehydrogenase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=gap PE=1 SV=3 4 333 1.0E-97
sp|P0A038|G3P_STAAU Glyceraldehyde-3-phosphate dehydrogenase OS=Staphylococcus aureus GN=gapA PE=3 SV=1 4 334 2.0E-97
sp|P0A037|G3P1_STAAW Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus aureus (strain MW2) GN=gapA1 PE=3 SV=1 4 334 2.0E-97
sp|Q6GB58|G3P1_STAAS Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus aureus (strain MSSA476) GN=gapA1 PE=3 SV=1 4 334 2.0E-97
sp|Q6GIL8|G3P1_STAAR Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus aureus (strain MRSA252) GN=gapA1 PE=1 SV=1 4 334 2.0E-97
sp|P99136|G3P1_STAAN Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus aureus (strain N315) GN=gapA1 PE=1 SV=1 4 334 2.0E-97
sp|P0A036|G3P1_STAAM Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gapA1 PE=3 SV=1 4 334 2.0E-97
sp|Q5HHP5|G3P1_STAAC Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus aureus (strain COL) GN=gapA1 PE=3 SV=1 4 334 2.0E-97
sp|P50321|G3PC_CUPNH Glyceraldehyde-3-phosphate dehydrogenase, chromosomal OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbGC PE=3 SV=1 4 332 2.0E-97
sp|P50322|G3PP_CUPNH Glyceraldehyde-3-phosphate dehydrogenase, plasmid OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=cbbGP PE=3 SV=1 4 332 3.0E-97
sp|P29272|G3P_RHOSH Glyceraldehyde-3-phosphate dehydrogenase OS=Rhodobacter sphaeroides GN=gapB PE=3 SV=1 4 326 5.0E-97
sp|P19866|G3PA_SPIOL Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Spinacia oleracea GN=GAPA PE=1 SV=2 2 332 1.0E-96
sp|Q6GG19|G3P2_STAAR Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus aureus (strain MRSA252) GN=gapA2 PE=3 SV=1 6 339 2.0E-96
sp|P34919|G3PA_CHOCR Glyceraldehyde-3-phosphate dehydrogenase, chloroplastic OS=Chondrus crispus GN=GAPA PE=2 SV=1 4 333 2.0E-96
sp|P25857|G3PB_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPB, chloroplastic OS=Arabidopsis thaliana GN=GAPB PE=1 SV=2 1 332 2.0E-96
sp|P12860|G3PB_SPIOL Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Spinacia oleracea GN=GAPB PE=1 SV=1 1 332 7.0E-96
sp|Q8CNY0|G3P2_STAES Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gapA2 PE=3 SV=1 6 334 9.0E-96
sp|P75358|G3P_MYCPN Glyceraldehyde-3-phosphate dehydrogenase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=gapA PE=3 SV=1 4 334 9.0E-96
sp|P68777|G3P_STRP8 Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=gap PE=3 SV=2 4 334 1.0E-95
sp|Q5XDW3|G3P_STRP6 Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=gap PE=1 SV=3 4 334 1.0E-95
sp|P0C0G7|G3P_STRP1 Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes serotype M1 GN=gap PE=3 SV=2 4 334 1.0E-95
sp|Q5HNL7|G3P2_STAEQ Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gapA2 PE=3 SV=1 6 334 1.0E-95
sp|P64181|G3P2_STAAW Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus aureus (strain MW2) GN=gapA2 PE=3 SV=1 6 339 2.0E-95
sp|Q6G8N9|G3P2_STAAS Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus aureus (strain MSSA476) GN=gapA2 PE=3 SV=1 6 339 2.0E-95
sp|P99067|G3P2_STAAN Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus aureus (strain N315) GN=gapA2 PE=1 SV=1 6 339 2.0E-95
sp|P64180|G3P2_STAAM Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gapA2 PE=3 SV=1 6 339 2.0E-95
sp|Q5HF86|G3P2_STAAC Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Staphylococcus aureus (strain COL) GN=gapA2 PE=3 SV=1 6 339 2.0E-95
sp|P0DB19|G3P_STRPQ Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=gap PE=3 SV=1 4 334 2.0E-95
sp|P0DB18|G3P_STRP3 Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=gap PE=3 SV=1 4 334 2.0E-95
sp|P0C0G6|G3P_STRPY Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus pyogenes GN=gap PE=1 SV=2 4 334 4.0E-95
sp|P09316|G3P_ZYMMO Glyceraldehyde-3-phosphate dehydrogenase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=gap PE=3 SV=1 4 333 9.0E-95
sp|Q01651|G3P_CORGL Glyceraldehyde-3-phosphate dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gap PE=3 SV=2 4 332 7.0E-94
sp|P47543|G3P_MYCGE Glyceraldehyde-3-phosphate dehydrogenase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=gapA PE=3 SV=1 4 334 7.0E-94
sp|P27726|G3P_PSEAE Glyceraldehyde-3-phosphate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gap PE=3 SV=3 4 326 8.0E-94
sp|Q82IZ2|G3P1_STRAW Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gap1 PE=1 SV=1 4 327 1.0E-93
sp|P30724|G3PA_GRAGA Glyceraldehyde-3-phosphate dehydrogenase, chloroplastic OS=Gracilaria gracilis GN=GAPA PE=2 SV=1 4 327 1.0E-93
sp|Q8CPY5|G3P1_STAES Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gapA1 PE=3 SV=1 4 334 5.0E-93
sp|Q5HQV4|G3P1_STAEQ Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gapA1 PE=3 SV=1 4 334 5.0E-93
sp|Q59800|G3P_STRAU Glyceraldehyde-3-phosphate dehydrogenase OS=Streptomyces aureofaciens GN=gap PE=3 SV=1 5 332 6.0E-93
sp|P09044|G3PB_TOBAC Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPB PE=2 SV=1 1 332 9.0E-93
sp|P80505|G3P2_SYNY3 Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gap2 PE=1 SV=3 5 333 4.0E-92
sp|P51009|G3P_XANFL Glyceraldehyde-3-phosphate dehydrogenase OS=Xanthobacter flavus GN=gap PE=3 SV=1 4 334 7.0E-92
sp|Q9LPW0|G3PA2_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPA2, chloroplastic OS=Arabidopsis thaliana GN=GAPA2 PE=2 SV=1 2 332 9.0E-92
sp|P50362|G3PA_CHLRE Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Chlamydomonas reinhardtii GN=GAPA PE=1 SV=1 4 333 2.0E-91
sp|P12859|G3PB_PEA Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Pisum sativum GN=GAPB PE=2 SV=2 1 332 3.0E-91
sp|Q59906|G3P_STREQ Glyceraldehyde-3-phosphate dehydrogenase OS=Streptococcus dysgalactiae subsp. equisimilis GN=gap PE=1 SV=2 4 334 2.0E-90
sp|P12858|G3PA_PEA Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Pisum sativum GN=GAPA PE=2 SV=2 4 332 2.0E-90
sp|P25856|G3PA1_ARATH Glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic OS=Arabidopsis thaliana GN=GAPA1 PE=1 SV=3 2 332 1.0E-89
sp|Q48335|G3P_HALVA Glyceraldehyde-3-phosphate dehydrogenase OS=Haloarcula vallismortis GN=gap PE=3 SV=1 3 333 3.0E-88
sp|P09315|G3PA_MAIZE Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Zea mays GN=GAPA PE=2 SV=1 2 327 4.0E-87
sp|P52987|G3P_LACLA Glyceraldehyde-3-phosphate dehydrogenase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gap PE=3 SV=2 4 334 4.0E-87
sp|O32755|G3P_LACDE Glyceraldehyde-3-phosphate dehydrogenase OS=Lactobacillus delbrueckii subsp. bulgaricus GN=gap PE=3 SV=1 4 334 2.0E-85
sp|P09043|G3PA_TOBAC Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPA PE=2 SV=1 2 332 1.0E-84
sp|Q8VXQ9|G3PA_SCEVA Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Scenedesmus vacuolatus GN=GapA PE=2 SV=1 9 319 2.0E-83
sp|P58559|G3P3_NOSS1 Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gap3 PE=2 SV=1 4 332 1.0E-79
sp|P34918|G3P3_ANAVT Glyceraldehyde-3-phosphate dehydrogenase 3 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gap3 PE=1 SV=2 4 332 1.0E-78
sp|A0KGD2|E4PD_AERHH D-erythrose-4-phosphate dehydrogenase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=epd PE=3 SV=1 4 326 1.0E-77
sp|A4SRF2|E4PD_AERS4 D-erythrose-4-phosphate dehydrogenase OS=Aeromonas salmonicida (strain A449) GN=epd PE=3 SV=1 4 326 4.0E-77
sp|Q3ILL8|E4PD_PSEHT D-erythrose-4-phosphate dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=epd PE=3 SV=1 4 326 5.0E-75
sp|Q087Q7|E4PD_SHEFN D-erythrose-4-phosphate dehydrogenase OS=Shewanella frigidimarina (strain NCIMB 400) GN=epd PE=3 SV=1 4 335 1.0E-74
sp|Q15QK3|E4PD_PSEA6 D-erythrose-4-phosphate dehydrogenase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=epd PE=3 SV=1 4 337 2.0E-74
sp|Q8EIB2|E4PD_SHEON D-erythrose-4-phosphate dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=epd PE=3 SV=1 4 332 2.0E-74
sp|A8H0M9|E4PD_SHEPA D-erythrose-4-phosphate dehydrogenase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|B0TUC0|E4PD_SHEHH D-erythrose-4-phosphate dehydrogenase OS=Shewanella halifaxensis (strain HAW-EB4) GN=epd PE=3 SV=1 4 326 3.0E-74
sp|A3QAX7|E4PD_SHELP D-erythrose-4-phosphate dehydrogenase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=epd PE=3 SV=1 4 326 4.0E-74
sp|Q0HRM3|E4PD_SHESR D-erythrose-4-phosphate dehydrogenase OS=Shewanella sp. (strain MR-7) GN=epd PE=3 SV=1 4 332 6.0E-74
sp|B8CU41|E4PD_SHEPW D-erythrose-4-phosphate dehydrogenase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=epd PE=3 SV=1 4 326 1.0E-73
sp|P55971|G3P_HELPY Glyceraldehyde-3-phosphate dehydrogenase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=gapA PE=3 SV=1 4 331 1.0E-73
sp|A0L0K7|E4PD_SHESA D-erythrose-4-phosphate dehydrogenase OS=Shewanella sp. (strain ANA-3) GN=epd PE=3 SV=1 4 332 1.0E-73
sp|Q0HM63|E4PD_SHESM D-erythrose-4-phosphate dehydrogenase OS=Shewanella sp. (strain MR-4) GN=epd PE=3 SV=1 4 332 2.0E-73
sp|A8APE1|E4PD_CITK8 D-erythrose-4-phosphate dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=epd PE=3 SV=1 4 334 3.0E-73
sp|B8E5U5|E4PD_SHEB2 D-erythrose-4-phosphate dehydrogenase OS=Shewanella baltica (strain OS223) GN=epd PE=3 SV=1 4 332 4.0E-73
sp|C6DFH8|E4PD_PECCP D-erythrose-4-phosphate dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=epd PE=3 SV=1 4 326 5.0E-73
sp|Q5QVL6|E4PD_IDILO D-erythrose-4-phosphate dehydrogenase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=epd PE=3 SV=1 3 333 9.0E-73
sp|A1RN69|E4PD_SHESW D-erythrose-4-phosphate dehydrogenase OS=Shewanella sp. (strain W3-18-1) GN=epd PE=3 SV=1 4 332 1.0E-72
sp|A7MJQ2|E4PD_CROS8 D-erythrose-4-phosphate dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=epd PE=3 SV=1 4 334 1.0E-72
sp|A9N3Q6|E4PD_SALPB D-erythrose-4-phosphate dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=epd PE=3 SV=1 4 334 2.0E-72
sp|Q7N7Z6|E4PD_PHOLL D-erythrose-4-phosphate dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=epd PE=3 SV=1 4 326 2.0E-72
sp|B5BFN5|E4PD_SALPK D-erythrose-4-phosphate dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=epd PE=3 SV=1 4 335 2.0E-72
sp|Q5PJI5|E4PD_SALPA D-erythrose-4-phosphate dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=epd PE=3 SV=1 4 335 2.0E-72
sp|B5RE31|E4PD_SALG2 D-erythrose-4-phosphate dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=epd PE=3 SV=1 4 334 2.0E-72
sp|Q7CPU5|E4PD_SALTY D-erythrose-4-phosphate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=epd PE=3 SV=1 4 334 3.0E-72
sp|Q8XGA4|E4PD_SALTI D-erythrose-4-phosphate dehydrogenase OS=Salmonella typhi GN=epd PE=3 SV=1 4 334 3.0E-72
sp|C0PY46|E4PD_SALPC D-erythrose-4-phosphate dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=epd PE=3 SV=1 4 334 3.0E-72
sp|B4T5H2|E4PD_SALNS D-erythrose-4-phosphate dehydrogenase OS=Salmonella newport (strain SL254) GN=epd PE=3 SV=1 4 334 3.0E-72
sp|B4THF4|E4PD_SALHS D-erythrose-4-phosphate dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=epd PE=3 SV=1 4 334 3.0E-72
sp|Q57K44|E4PD_SALCH D-erythrose-4-phosphate dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=epd PE=3 SV=1 4 334 3.0E-72
sp|B5F5J5|E4PD_SALA4 D-erythrose-4-phosphate dehydrogenase OS=Salmonella agona (strain SL483) GN=epd PE=3 SV=1 4 334 3.0E-72
sp|B4TV39|E4PD_SALSV D-erythrose-4-phosphate dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=epd PE=3 SV=1 4 334 3.0E-72
sp|B7LPD5|E4PD_ESCF3 D-erythrose-4-phosphate dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=epd PE=3 SV=1 4 334 3.0E-72
sp|B5QXJ7|E4PD_SALEP D-erythrose-4-phosphate dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=epd PE=3 SV=1 4 334 4.0E-72
sp|B5FUI3|E4PD_SALDC D-erythrose-4-phosphate dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=epd PE=3 SV=1 4 334 4.0E-72
sp|A4Y3R9|E4PD_SHEPC D-erythrose-4-phosphate dehydrogenase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=epd PE=3 SV=1 4 332 4.0E-72
sp|B5XUB7|E4PD_KLEP3 D-erythrose-4-phosphate dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=epd PE=3 SV=1 4 334 6.0E-72
sp|Q9ZKT0|G3P_HELPJ Glyceraldehyde-3-phosphate dehydrogenase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=gapA PE=3 SV=1 4 331 6.0E-72
sp|Q3YXU5|E4PD_SHISS D-erythrose-4-phosphate dehydrogenase OS=Shigella sonnei (strain Ss046) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|P0A9B9|E4PD_SHIFL D-erythrose-4-phosphate dehydrogenase OS=Shigella flexneri GN=epd PE=3 SV=2 4 334 7.0E-72
sp|Q0T0X3|E4PD_SHIF8 D-erythrose-4-phosphate dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|Q31WI6|E4PD_SHIBS D-erythrose-4-phosphate dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|B2U0U3|E4PD_SHIB3 D-erythrose-4-phosphate dehydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|B1LDD2|E4PD_ECOSM D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|B6I761|E4PD_ECOSE D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain SE11) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|B7N7H3|E4PD_ECOLU D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|P0A9B6|E4PD_ECOLI D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain K12) GN=epd PE=1 SV=2 4 334 7.0E-72
sp|B1IT76|E4PD_ECOLC D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|P0A9B7|E4PD_ECOL6 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=epd PE=3 SV=2 4 334 7.0E-72
sp|Q0TDS9|E4PD_ECOL5 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|A8A467|E4PD_ECOHS D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|B1XEL0|E4PD_ECODH D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|C5A0J7|E4PD_ECOBW D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|B7LYU4|E4PD_ECO8A D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|B5YQB9|E4PD_ECO5E D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|P0A9B8|E4PD_ECO57 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O157:H7 GN=epd PE=3 SV=2 4 334 7.0E-72
sp|B7LFI3|E4PD_ECO55 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|A7ZR35|E4PD_ECO24 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|Q32BY7|E4PD_SHIDS D-erythrose-4-phosphate dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=epd PE=3 SV=1 4 334 7.0E-72
sp|B4RWC5|E4PD_ALTMD D-erythrose-4-phosphate dehydrogenase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=epd PE=3 SV=1 4 326 8.0E-72
sp|A1AFB1|E4PD_ECOK1 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=epd PE=3 SV=1 4 334 8.0E-72
sp|B7MMA9|E4PD_ECO45 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=epd PE=3 SV=1 4 334 8.0E-72
sp|Q1R7A6|E4PD_ECOUT D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=epd PE=3 SV=2 4 334 9.0E-72
sp|B7MZM0|E4PD_ECO81 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=epd PE=3 SV=1 4 334 9.0E-72
sp|B7UHW9|E4PD_ECO27 D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=epd PE=3 SV=1 4 334 9.0E-72
sp|A4WE72|E4PD_ENT38 D-erythrose-4-phosphate dehydrogenase OS=Enterobacter sp. (strain 638) GN=epd PE=3 SV=1 4 326 1.0E-71
sp|A6TDT2|E4PD_KLEP7 D-erythrose-4-phosphate dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=epd PE=3 SV=1 4 334 1.0E-71
sp|A9MRF0|E4PD_SALAR D-erythrose-4-phosphate dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=epd PE=3 SV=1 4 334 2.0E-71
sp|Q6LMN0|E4PD_PHOPR D-erythrose-4-phosphate dehydrogenase OS=Photobacterium profundum GN=epd PE=3 SV=2 4 338 3.0E-71
sp|B7NHY6|E4PD_ECO7I D-erythrose-4-phosphate dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=epd PE=3 SV=1 4 334 5.0E-71
sp|B4EUH7|E4PD_PROMH D-erythrose-4-phosphate dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=epd PE=3 SV=1 4 326 8.0E-71
sp|Q6D086|E4PD_PECAS D-erythrose-4-phosphate dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=epd PE=3 SV=1 4 326 8.0E-71
sp|Q12QA4|E4PD_SHEDO D-erythrose-4-phosphate dehydrogenase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=epd PE=3 SV=2 4 326 9.0E-71
sp|A1S9A4|E4PD_SHEAM D-erythrose-4-phosphate dehydrogenase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=epd PE=3 SV=1 4 336 1.0E-70
sp|C4L9J3|E4PD_TOLAT D-erythrose-4-phosphate dehydrogenase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=epd PE=3 SV=1 4 334 3.0E-70
sp|P46796|G3P_BORHE Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Borrelia hermsii GN=gap PE=3 SV=1 37 291 5.0E-69
sp|A7MTQ2|E4PD_VIBCB D-erythrose-4-phosphate dehydrogenase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=epd PE=3 SV=1 4 326 4.0E-68
sp|Q87LL0|E4PD_VIBPA D-erythrose-4-phosphate dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=epd PE=3 SV=1 4 326 7.0E-68
sp|B2VF24|E4PD_ERWT9 D-erythrose-4-phosphate dehydrogenase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=epd PE=3 SV=1 4 326 3.0E-67
sp|A1JPR1|E4PD_YERE8 D-erythrose-4-phosphate dehydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=epd PE=3 SV=1 4 333 4.0E-67
sp|Q666Q0|E4PD_YERPS D-erythrose-4-phosphate dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=epd PE=3 SV=1 4 333 9.0E-67
sp|Q1CEY2|E4PD_YERPN D-erythrose-4-phosphate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=epd PE=3 SV=1 4 333 9.0E-67
sp|Q7CGS4|E4PD_YERPE D-erythrose-4-phosphate dehydrogenase OS=Yersinia pestis GN=epd PE=3 SV=1 4 333 9.0E-67
sp|Q1CB62|E4PD_YERPA D-erythrose-4-phosphate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=epd PE=3 SV=1 4 333 9.0E-67
sp|B5F9T4|E4PD_VIBFM D-erythrose-4-phosphate dehydrogenase OS=Vibrio fischeri (strain MJ11) GN=epd PE=3 SV=1 4 333 1.0E-66
sp|Q8DCA1|E4PD_VIBVU D-erythrose-4-phosphate dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=epd PE=3 SV=1 4 326 1.0E-66
sp|Q7MHL0|E4PD_VIBVY D-erythrose-4-phosphate dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=epd PE=3 SV=1 4 326 1.0E-66
sp|B6EMW1|E4PD_ALISL D-erythrose-4-phosphate dehydrogenase OS=Aliivibrio salmonicida (strain LFI1238) GN=epd PE=3 SV=1 4 326 4.0E-66
sp|Q5E7R0|E4PD_VIBF1 D-erythrose-4-phosphate dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=epd PE=3 SV=1 4 333 2.0E-65
sp|P0C6C2|E4PD_VIBCH D-erythrose-4-phosphate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=epd PE=3 SV=1 4 326 3.0E-65
sp|A5F9G1|E4PD_VIBC3 D-erythrose-4-phosphate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=epd PE=1 SV=2 4 326 3.0E-65
sp|A1SVN9|E4PD_PSYIN D-erythrose-4-phosphate dehydrogenase OS=Psychromonas ingrahamii (strain 37) GN=epd PE=3 SV=1 4 339 8.0E-65
sp|C5BAU7|E4PD_EDWI9 D-erythrose-4-phosphate dehydrogenase OS=Edwardsiella ictaluri (strain 93-146) GN=epd PE=3 SV=1 4 333 1.0E-64
sp|Q47XD5|E4PD_COLP3 D-erythrose-4-phosphate dehydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=epd PE=3 SV=1 4 326 3.0E-64
sp|P09672|G3PA_SINAL Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Sinapis alba GN=GAPA PE=2 SV=1 108 332 8.0E-62
sp|P70685|G3P_CAVPO Glyceraldehyde-3-phosphate dehydrogenase (Fragment) OS=Cavia porcellus GN=GAPDH PE=2 SV=2 170 291 2.0E-56
sp|Q02PG5|GAP2_PSEAB Glyceraldehyde-3-phosphate dehydrogenase-like protein OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=gap2 PE=1 SV=1 10 335 1.0E-47
sp|P86211|G3PT_MESAU Glyceraldehyde-3-phosphate dehydrogenase, testis-specific (Fragments) OS=Mesocricetus auratus GN=GAPDHS PE=1 SV=1 4 54 7.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10752
MAPIKVGINGFGRIGRIVLRNAIEHSEIQIVAVNDPFIDTEYAAYMLKYDSTHGNFKGDIAITGSDLSINGNKVK
FYTERDPAAIPWKETGAEYIVESTGVFTTTDKAKAHLKGGAKKVIISAPSSDAPMYVMGVNEKTYDGKADVISNA
SCTTNCLAPLAKVIHDKFTIIEGLMTTIHSYTATQKTVDGPSGKDWRGGRAAAQNIIPSSTGAAKAVGKVIPDLN
GKLTGMSMRVPTSNVSVVDLTARIEKGASYDEIKAAVKEAANGPLKNILAYCDEDIVSSDMNGNTHSSIFDAKAG
ISLNPNFVKVVSWYDNEWGYSRRVCDLLAYIAKVDAGKK*
Coding >Hirsu2|10752
ATGGCTCCCATCAAGGTCGGCATCAATGGCTTCGGCCGCATCGGCCGCATCGTCCTCCGCAATGCCATCGAGCAC
TCCGAGATCCAGATCGTCGCCGTCAATGACCCTTTCATCGACACGGAATACGCCGCCTACATGCTCAAGTATGAC
TCTACCCACGGCAACTTCAAGGGCGATATCGCCATCACCGGCAGCGACCTGTCCATAAACGGCAACAAGGTCAAG
TTCTACACGGAGCGCGACCCGGCCGCCATCCCCTGGAAGGAGACTGGTGCCGAGTACATCGTCGAGTCCACCGGC
GTCTTCACCACCACCGACAAGGCCAAGGCTCATCTCAAGGGAGGCGCCAAGAAAGTCATCATCTCGGCTCCTTCG
TCCGACGCCCCCATGTACGTCATGGGCGTCAACGAGAAGACGTACGACGGCAAGGCCGACGTCATCTCCAACGCC
TCTTGCACCACCAACTGCCTGGCCCCCCTGGCCAAGGTCATCCACGACAAGTTCACCATCATCGAGGGCCTCATG
ACCACCATCCACTCCTACACCGCCACCCAGAAGACCGTCGACGGCCCCTCCGGCAAGGACTGGCGAGGCGGGCGC
GCTGCCGCTCAGAACATCATCCCCAGCAGCACGGGCGCCGCCAAGGCCGTCGGTAAGGTCATCCCCGACCTTAAC
GGCAAGCTCACCGGCATGTCGATGCGCGTGCCCACCTCCAACGTCTCCGTCGTCGACCTGACGGCCCGCATCGAG
AAGGGCGCCTCGTACGACGAGATCAAGGCGGCCGTCAAGGAGGCCGCCAACGGCCCTCTCAAGAACATTCTCGCC
TACTGCGACGAGGACATCGTCTCCAGCGACATGAACGGCAACACACACTCGTCCATTTTCGACGCCAAGGCCGGC
ATCTCGCTCAACCCCAACTTCGTCAAGGTCGTCAGCTGGTACGACAACGAGTGGGGCTACTCCCGCCGCGTCTGC
GACCTCCTGGCCTACATTGCCAAGGTTGACGCCGGCAAGAAGTAA
Transcript >Hirsu2|10752
ATGGCTCCCATCAAGGTCGGCATCAATGGCTTCGGCCGCATCGGCCGCATCGTCCTCCGCAATGCCATCGAGCAC
TCCGAGATCCAGATCGTCGCCGTCAATGACCCTTTCATCGACACGGAATACGCCGCCTACATGCTCAAGTATGAC
TCTACCCACGGCAACTTCAAGGGCGATATCGCCATCACCGGCAGCGACCTGTCCATAAACGGCAACAAGGTCAAG
TTCTACACGGAGCGCGACCCGGCCGCCATCCCCTGGAAGGAGACTGGTGCCGAGTACATCGTCGAGTCCACCGGC
GTCTTCACCACCACCGACAAGGCCAAGGCTCATCTCAAGGGAGGCGCCAAGAAAGTCATCATCTCGGCTCCTTCG
TCCGACGCCCCCATGTACGTCATGGGCGTCAACGAGAAGACGTACGACGGCAAGGCCGACGTCATCTCCAACGCC
TCTTGCACCACCAACTGCCTGGCCCCCCTGGCCAAGGTCATCCACGACAAGTTCACCATCATCGAGGGCCTCATG
ACCACCATCCACTCCTACACCGCCACCCAGAAGACCGTCGACGGCCCCTCCGGCAAGGACTGGCGAGGCGGGCGC
GCTGCCGCTCAGAACATCATCCCCAGCAGCACGGGCGCCGCCAAGGCCGTCGGTAAGGTCATCCCCGACCTTAAC
GGCAAGCTCACCGGCATGTCGATGCGCGTGCCCACCTCCAACGTCTCCGTCGTCGACCTGACGGCCCGCATCGAG
AAGGGCGCCTCGTACGACGAGATCAAGGCGGCCGTCAAGGAGGCCGCCAACGGCCCTCTCAAGAACATTCTCGCC
TACTGCGACGAGGACATCGTCTCCAGCGACATGAACGGCAACACACACTCGTCCATTTTCGACGCCAAGGCCGGC
ATCTCGCTCAACCCCAACTTCGTCAAGGTCGTCAGCTGGTACGACAACGAGTGGGGCTACTCCCGCCGCGTCTGC
GACCTCCTGGCCTACATTGCCAAGGTTGACGCCGGCAAGAAGTAA
Gene >Hirsu2|10752
ATGGCTCCCATCAAGGTCGGCATCAATGGCTTCGGCCGCATCGGCCGCATCGTCCTCCGCAATGCCATCGAGCAC
TCCGAGATCCAGATCGTCGCCGTCAATGACCCTTTCATCGACACGGAATACGCCGTAAGTTGTTGTGCCGCAGCG
GCCGCTGCCCCTCCCCAACACTCTCAGATTCCCCTCCACCCCGCTCGAGCACAGCAATTTTTCTCCCACCCATGC
CCGTCCCCCCTCCATGAGATCATGTGTGGGGACGCAGCAGCCTTGGACAGCAACTTTTCCGCTTTCCCGGCTGAG
CCGCGCTGACCTCGCCTCTTCTTCCACCGCAGGCCTACATGCTCAAGTATGACTCTACCCACGGCAACTTCAAGG
GCGATATCGCCATCACCGGCAGCGACCTGTCCATAAACGGCAACAAGGTCAAGTTCTACACGGAGCGCGACCCGG
CCGCCATCCCCTGGAAGGAGACTGGTGCCGAGTACATCGTCGAGTCCACCGGCGTCTTCACCACCACCGACAAGG
CCAAGGCTCATCTCAAGGGAGGCGCCAAGAAAGTCATCATCTCGGCTCCTTCGTCCGACGCCCCCATGTACGTCA
TGGGCGTCAACGAGAAGACGTACGACGGCAAGGCCGACGTCATCTCCAACGCCTCTTGCACCACCAACTGCCTGG
CCCCCCTGGCCAAGGTCATCCACGACAAGTTCACCATCATCGAGGGCCTCATGACCACCATCCACTCCTACACCG
CCACCCAGAAGACCGTCGACGGCCCCTCCGGCAAGGACTGGCGAGGCGGGCGCGCTGCCGCTCAGAACATCATCC
CCAGCAGCACGGGCGCCGCCAAGGCCGTCGGTAAGGTCATCCCCGACCTTAACGGCAAGCTCACCGGCATGTCGA
TGCGCGTGCCCACCTCCAACGTCTCCGTCGTCGACCTGACGGCCCGCATCGAGAAGGGCGCCTCGTACGACGAGA
TCAAGGCGGCCGTCAAGGAGGCCGCCAACGGCCCTCTCAAGAACATTCTCGCCTACTGCGACGAGGACATCGTCT
CCAGCGACATGAACGGCAACACACACTCGTCCATTTTCGACGCCAAGGCCGGCATCTCGCTCAACCCCAACTTCG
TCAAGGTCGTCAGCTGGTACGACAACGAGTGGGGCTACTCCCGCCGCGTCTGCGACCTCCTGGCCTACATTGCCA
AGGTTGACGCCGGCAAGAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail