Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10742
Gene name
LocationContig_9:11885..12394
Strand-
Gene length (bp)509
Transcript length (bp)453
Coding sequence length (bp)453
Protein length (aa) 151

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.6E-16 11 83

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C1I2|PPIE_RHIO9 Peptidyl-prolyl cis-trans isomerase E OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp10 PE=3 SV=1 8 129 8.0E-23
sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 8 116 7.0E-21
sp|A4FV72|PPIE_BOVIN Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 8 116 7.0E-21
sp|Q5R723|PPIE_PONAB Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 8 116 8.0E-21
sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 8 116 8.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C1I2|PPIE_RHIO9 Peptidyl-prolyl cis-trans isomerase E OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp10 PE=3 SV=1 8 129 8.0E-23
sp|Q9QZH3|PPIE_MOUSE Peptidyl-prolyl cis-trans isomerase E OS=Mus musculus GN=Ppie PE=1 SV=2 8 116 7.0E-21
sp|A4FV72|PPIE_BOVIN Peptidyl-prolyl cis-trans isomerase E OS=Bos taurus GN=PPIE PE=2 SV=1 8 116 7.0E-21
sp|Q5R723|PPIE_PONAB Peptidyl-prolyl cis-trans isomerase E OS=Pongo abelii GN=PPIE PE=2 SV=1 8 116 8.0E-21
sp|Q9UNP9|PPIE_HUMAN Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens GN=PPIE PE=1 SV=1 8 116 8.0E-21
sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 8 116 3.0E-20
sp|Q4G338|PPIE_HAECO Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 8 121 2.0E-19
sp|O94359|YHOC_SCHPO Uncharacterized RNA-binding protein C428.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.12c PE=3 SV=2 6 96 3.0E-12
sp|Q26548|PPIE_SCHMA Peptidyl-prolyl cis-trans isomerase E OS=Schistosoma mansoni PE=1 SV=2 49 115 2.0E-11
sp|Q54PB2|MRD1_DICDI Multiple RNA-binding domain-containing protein 1 OS=Dictyostelium discoideum GN=mrd1 PE=3 SV=1 9 96 2.0E-09
sp|Q10B98|C3H25_ORYSJ Zinc finger CCCH domain-containing protein 25 OS=Oryza sativa subsp. japonica GN=Os03g0826400 PE=2 SV=1 9 87 2.0E-08
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 10 100 2.0E-08
sp|Q9SD61|C3H42_ARATH Zinc finger CCCH domain-containing protein 42 OS=Arabidopsis thaliana GN=At3g47120 PE=2 SV=1 9 96 3.0E-08
sp|Q9XFR5|SR30_ARATH Serine/arginine-rich splicing factor SR30 OS=Arabidopsis thaliana GN=SR30 PE=1 SV=1 4 88 9.0E-08
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 10 102 2.0E-07
sp|Q9R0U0|SRS10_MOUSE Serine/arginine-rich splicing factor 10 OS=Mus musculus GN=Srsf10 PE=1 SV=2 9 101 2.0E-07
sp|Q6DJI9|ZCRB1_XENLA Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Xenopus laevis GN=zcrb1 PE=2 SV=1 8 89 2.0E-07
sp|O75494|SRS10_HUMAN Serine/arginine-rich splicing factor 10 OS=Homo sapiens GN=SRSF10 PE=1 SV=1 9 101 2.0E-07
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 10 93 2.0E-07
sp|Q10422|YDC1_SCHPO Uncharacterized RNA-binding protein C25G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25G10.01 PE=1 SV=1 11 89 5.0E-07
sp|Q8WXF0|SRS12_HUMAN Serine/arginine-rich splicing factor 12 OS=Homo sapiens GN=SRSF12 PE=2 SV=1 9 101 2.0E-06
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 10 89 3.0E-06
sp|P0CR16|MRD1_CRYNJ Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MRD1 PE=3 SV=1 3 83 4.0E-06
sp|P0CR17|MRD1_CRYNB Multiple RNA-binding domain-containing protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MRD1 PE=3 SV=1 3 83 4.0E-06
sp|Q13310|PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 9 89 5.0E-06
sp|Q6AYL5|SF3B4_RAT Splicing factor 3B subunit 4 OS=Rattus norvegicus GN=Sf3b4 PE=2 SV=1 9 97 6.0E-06
sp|Q8QZY9|SF3B4_MOUSE Splicing factor 3B subunit 4 OS=Mus musculus GN=Sf3b4 PE=1 SV=1 9 97 6.0E-06
sp|Q15427|SF3B4_HUMAN Splicing factor 3B subunit 4 OS=Homo sapiens GN=SF3B4 PE=1 SV=1 9 97 6.0E-06
sp|Q09442|SF3B4_CAEEL Splicing factor 3B subunit 4 OS=Caenorhabditis elegans GN=sap-49 PE=1 SV=2 9 97 8.0E-06
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 9 98 8.0E-06
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 9 98 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5198 0.6649 0.0117 0.0168 0.055 0.0144 0.0433 0.0146 0.0363 0.001

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1342
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4338
Ophiocordyceps australis map64 (Brazil) OphauB2|3286
Ophiocordyceps camponoti-floridani Ophcf2|06680
Ophiocordyceps camponoti-rufipedis Ophun1|101
Ophiocordyceps kimflemingae Ophio5|7450
Ophiocordyceps subramaniannii Hirsu2|10742 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10742
MTEAGRWKATVFVKGFPQSVTASHIHAAFLPFGEIVDVQLPKADARDPADSHRGFAYVEFEDYADAEEAIDNMDQ
SEFFGRILKVTHAKAPKNADEGLGSKKAVWEQEGWLAEHAGGQDVATEDHKMEDMILDPMQGLEGLDVAGPKPAA
*
Coding >Hirsu2|10742
ATGACGGAGGCAGGTCGCTGGAAGGCCACCGTCTTTGTGAAAGGGTTCCCGCAGTCGGTCACAGCCAGCCATATC
CACGCCGCCTTCTTACCATTTGGCGAGATTGTCGATGTGCAGCTCCCCAAAGCAGATGCACGAGACCCGGCAGAC
TCGCATCGCGGCTTCGCATATGTGGAATTTGAAGACTATGCCGATGCCGAGGAAGCAATAGACAATATGGACCAG
TCAGAGTTCTTCGGTCGGATTCTCAAAGTGACGCATGCGAAGGCACCCAAGAATGCCGACGAGGGACTGGGCAGC
AAGAAAGCTGTCTGGGAACAGGAGGGCTGGCTAGCAGAGCATGCCGGCGGCCAAGACGTGGCGACCGAGGACCAC
AAAATGGAGGATATGATCTTGGATCCCATGCAGGGGCTCGAGGGGCTCGATGTAGCCGGGCCAAAGCCGGCGGCG
TAG
Transcript >Hirsu2|10742
ATGACGGAGGCAGGTCGCTGGAAGGCCACCGTCTTTGTGAAAGGGTTCCCGCAGTCGGTCACAGCCAGCCATATC
CACGCCGCCTTCTTACCATTTGGCGAGATTGTCGATGTGCAGCTCCCCAAAGCAGATGCACGAGACCCGGCAGAC
TCGCATCGCGGCTTCGCATATGTGGAATTTGAAGACTATGCCGATGCCGAGGAAGCAATAGACAATATGGACCAG
TCAGAGTTCTTCGGTCGGATTCTCAAAGTGACGCATGCGAAGGCACCCAAGAATGCCGACGAGGGACTGGGCAGC
AAGAAAGCTGTCTGGGAACAGGAGGGCTGGCTAGCAGAGCATGCCGGCGGCCAAGACGTGGCGACCGAGGACCAC
AAAATGGAGGATATGATCTTGGATCCCATGCAGGGGCTCGAGGGGCTCGATGTAGCCGGGCCAAAGCCGGCGGCG
TAG
Gene >Hirsu2|10742
ATGACGGAGGCAGGTCGCTGGAAGGCCACCGTCTTTGTGAAAGGGTTCCCGCAGTCGGTCACAGCCAGCCATATC
CACGCCGCCTTCTTACCATTTGGCGAGATTGTCGATGTGCAGCTCCCCAAAGCAGATGCACGAGACCCGGCAGAC
TCGCATCGCGGCTTCGCATATGTGGAATTTGAAGACTATGCCGATGCCGAGGAAGCAATAGACAATATGGACCAG
TCAGAGTTCTTCGGTCGGATTCTCAAAGTGACGCATGCGAAGGCACCCAAGAATGCCGACGAGGGACTGGGCAGC
AAGAAAGCTGTCTGGGAACAGGTAAGCTGGCGCGAACGTCCATCTACGAGCCATTTTCTGACAAATGCCACGCAC
AGGAGGGCTGGCTAGCAGAGCATGCCGGCGGCCAAGACGTGGCGACCGAGGACCACAAAATGGAGGATATGATCT
TGGATCCCATGCAGGGGCTCGAGGGGCTCGATGTAGCCGGGCCAAAGCCGGCGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail