Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10739
Gene name
LocationContig_9:9066..9915
Strand+
Gene length (bp)849
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13019 Sde2_N_Ubi Silencing defective 2 N-terminal ubiquitin domain 7.1E-69 7 168

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14113|SDE2_SCHPO Telomere maintenance protein SDE2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sde2 PE=3 SV=1 29 200 2.0E-20
sp|Q7T293|SDE2_DANRE Protein SDE2 homolog OS=Danio rerio GN=sde2 PE=2 SV=2 83 206 6.0E-12
sp|Q07G43|SDE2_XENTR Protein SDE2 homolog OS=Xenopus tropicalis GN=sde2 PE=2 SV=1 86 156 3.0E-11
sp|Q6IQ49|SDE2_HUMAN Protein SDE2 homolog OS=Homo sapiens GN=SDE2 PE=1 SV=1 66 208 4.0E-11
sp|Q5RET9|SDE2_PONAB Protein SDE2 homolog OS=Pongo abelii GN=SDE2 PE=2 SV=1 66 208 7.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14113|SDE2_SCHPO Telomere maintenance protein SDE2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sde2 PE=3 SV=1 29 200 2.0E-20
sp|Q7T293|SDE2_DANRE Protein SDE2 homolog OS=Danio rerio GN=sde2 PE=2 SV=2 83 206 6.0E-12
sp|Q07G43|SDE2_XENTR Protein SDE2 homolog OS=Xenopus tropicalis GN=sde2 PE=2 SV=1 86 156 3.0E-11
sp|Q6IQ49|SDE2_HUMAN Protein SDE2 homolog OS=Homo sapiens GN=SDE2 PE=1 SV=1 66 208 4.0E-11
sp|Q5RET9|SDE2_PONAB Protein SDE2 homolog OS=Pongo abelii GN=SDE2 PE=2 SV=1 66 208 7.0E-11
sp|Q6NRI5|SDE2_XENLA Protein SDE2 homolog OS=Xenopus laevis GN=sde2 PE=2 SV=1 88 156 8.0E-11
sp|Q8K1J5|SDE2_MOUSE Protein SDE2 homolog OS=Mus musculus GN=Sde2 PE=1 SV=1 90 212 2.0E-08
sp|Q5BJN8|SDE2_RAT Protein SDE2 homolog OS=Rattus norvegicus GN=Sde2 PE=1 SV=2 90 156 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10739
MASQILNVLVATFGGLGLPSTLVVPVSHATTVTRLREEINHRLPATDSRLILTTLSNRQLPERSEAPISTYISTS
HDEFLSLRLAVPLCGGKGGFGSQLRAAGGRMSSRKNRNQDDHGSSRNLDGRRLRTVNEAKALAEYLAIKPDMEKK
EKEKRRKRWEQIVQMSEQKETEIRSGNTARLDGKWVEDKEESNEKTRDAVLAAMKSGNYTDTLLGTSNGSTSTDR
GSNRSSSSGGDRASSKELSPASDRETTQKSKPRTFFGFEEDDEFMTSEDEDSGTTRE*
Coding >Hirsu2|10739
ATGGCTTCGCAAATCCTCAACGTCTTGGTTGCTACTTTCGGCGGCCTGGGCTTGCCCTCGACTCTCGTCGTACCA
GTGTCGCACGCGACCACCGTCACCCGGCTACGGGAGGAGATCAACCACAGGCTGCCTGCAACCGACAGCAGACTC
ATCTTGACGACACTGTCAAACAGACAACTTCCCGAGCGGTCGGAGGCTCCTATTTCCACGTATATCTCCACGAGC
CACGATGAGTTTCTTTCCCTACGACTGGCCGTGCCGCTGTGCGGCGGCAAAGGAGGGTTCGGGTCGCAGCTTAGG
GCTGCCGGAGGACGAATGTCGTCGCGCAAAAACCGAAACCAAGACGACCATGGGTCAAGCCGAAACCTCGACGGT
CGAAGACTCCGGACGGTCAACGAAGCCAAGGCTTTGGCAGAATATCTTGCCATCAAGCCAGACATGGAGAAAAAG
GAGAAGGAAAAGCGACGGAAGCGCTGGGAGCAGATTGTTCAAATGTCTGAGCAAAAAGAAACCGAGATAAGGTCA
GGCAACACCGCCCGACTCGATGGCAAATGGGTTGAGGACAAGGAAGAGAGCAACGAGAAGACGCGAGACGCCGTA
CTGGCTGCAATGAAGTCCGGAAACTACACAGACACTCTTCTGGGCACATCCAACGGCTCTACCTCCACGGATCGA
GGTTCCAACCGCAGCAGCTCCAGTGGAGGGGATCGAGCTAGTTCCAAGGAGTTATCGCCAGCGTCAGACCGGGAA
ACCACACAGAAGAGCAAACCGAGGACCTTTTTCGGGTTCGAGGAAGATGATGAGTTCATGACTTCCGAGGATGAG
GACAGCGGAACGACGAGGGAATGA
Transcript >Hirsu2|10739
ATGGCTTCGCAAATCCTCAACGTCTTGGTTGCTACTTTCGGCGGCCTGGGCTTGCCCTCGACTCTCGTCGTACCA
GTGTCGCACGCGACCACCGTCACCCGGCTACGGGAGGAGATCAACCACAGGCTGCCTGCAACCGACAGCAGACTC
ATCTTGACGACACTGTCAAACAGACAACTTCCCGAGCGGTCGGAGGCTCCTATTTCCACGTATATCTCCACGAGC
CACGATGAGTTTCTTTCCCTACGACTGGCCGTGCCGCTGTGCGGCGGCAAAGGAGGGTTCGGGTCGCAGCTTAGG
GCTGCCGGAGGACGAATGTCGTCGCGCAAAAACCGAAACCAAGACGACCATGGGTCAAGCCGAAACCTCGACGGT
CGAAGACTCCGGACGGTCAACGAAGCCAAGGCTTTGGCAGAATATCTTGCCATCAAGCCAGACATGGAGAAAAAG
GAGAAGGAAAAGCGACGGAAGCGCTGGGAGCAGATTGTTCAAATGTCTGAGCAAAAAGAAACCGAGATAAGGTCA
GGCAACACCGCCCGACTCGATGGCAAATGGGTTGAGGACAAGGAAGAGAGCAACGAGAAGACGCGAGACGCCGTA
CTGGCTGCAATGAAGTCCGGAAACTACACAGACACTCTTCTGGGCACATCCAACGGCTCTACCTCCACGGATCGA
GGTTCCAACCGCAGCAGCTCCAGTGGAGGGGATCGAGCTAGTTCCAAGGAGTTATCGCCAGCGTCAGACCGGGAA
ACCACACAGAAGAGCAAACCGAGGACCTTTTTCGGGTTCGAGGAAGATGATGAGTTCATGACTTCCGAGGATGAG
GACAGCGGAACGACGAGGGAATGA
Gene >Hirsu2|10739
ATGGCTTCGCAAATCCTCAACGTCTTGGTTGCTACTTTCGGCGGCCTGGGCTTGCCCTCGACTCTCGTCGTACCA
GTGTCGCACGCGACCACCGTCACCCGGCTACGGGAGGAGATCAACCACAGGCTGCCTGCAACCGACAGCAGACTC
ATCTTGACGACACTGTCAAACAGACAACTTCCCGAGCGGTCGGAGGCTCCTATTTCCACGTATATCTCCACGAGC
CACGATGAGTTTCTTTCCCTACGACTGGCCGTGCCGCTGTGCGGCGGCAAAGGAGGGTTCGGGTCGCAGCTTAGG
GCTGCCGGAGGACGAATGTCGTCGCGCAAAAACCGAAACCAAGACGACCATGGGTCAAGCCGAAACCTCGACGGT
CGAAGACTCCGGACGGTCAACGAAGCCAAGGCTTTGGCAGAATATCTTGCCATCAAGCCAGACATGGAGAAAAAG
GAGAAGGAAAAGCGACGGAAGCGCTGGGAGCAGATTGTTCAAATGTCTGAGCAAAAAGAAACCGAGATAAGGTCA
GGCAACACCGCCCGACTCGATGGCAAATGGGTTGAGGACAAGGAAGAGAGCAACGAGAAGACGCGAGACGCCGTA
CTGGCTGCAATGAAGTCCGGAAACTACACAGACACTCTTCTGGGCACATCCAACGGCTCTACCTCCACGGATCGA
GGTTCCAACCGCAGCAGCTCCAGTGGAGGGGATCGAGCTAGTTCCAAGGAGTTATCGCCAGCGTCAGACCGGGAA
ACCACACAGAAGAGCAAACCGAGGACCTTTTTCGGGTTCGAGGAAGATGATGAGTTCATGACTTCCGAGGATGAG
GACAGCGGAACGACGAGGGAATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail