Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10738
Gene name
LocationContig_9:8158..8772
Strand-
Gene length (bp)614
Transcript length (bp)492
Coding sequence length (bp)492
Protein length (aa) 164

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03501 S10_plectin Plectin/S10 domain 2.2E-42 3 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13614|RS10B_SCHPO 40S ribosomal protein S10-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1002 PE=3 SV=1 1 160 3.0E-56
sp|O14112|RS10A_SCHPO 40S ribosomal protein S10-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1001 PE=3 SV=1 1 156 2.0E-55
sp|Q08745|RS10A_YEAST 40S ribosomal protein S10-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS10A PE=1 SV=1 1 94 1.0E-45
sp|P46784|RS10B_YEAST 40S ribosomal protein S10-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS10B PE=1 SV=1 1 102 4.0E-45
sp|O77302|RS10_LUMRU 40S ribosomal protein S10 OS=Lumbricus rubellus GN=RPS10 PE=2 SV=1 1 158 2.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13614|RS10B_SCHPO 40S ribosomal protein S10-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1002 PE=3 SV=1 1 160 3.0E-56
sp|O14112|RS10A_SCHPO 40S ribosomal protein S10-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps1001 PE=3 SV=1 1 156 2.0E-55
sp|Q08745|RS10A_YEAST 40S ribosomal protein S10-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS10A PE=1 SV=1 1 94 1.0E-45
sp|P46784|RS10B_YEAST 40S ribosomal protein S10-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS10B PE=1 SV=1 1 102 4.0E-45
sp|O77302|RS10_LUMRU 40S ribosomal protein S10 OS=Lumbricus rubellus GN=RPS10 PE=2 SV=1 1 158 2.0E-43
sp|Q962R9|RS10_SPOFR 40S ribosomal protein S10 OS=Spodoptera frugiperda GN=RpS10 PE=2 SV=1 1 161 2.0E-42
sp|Q9AYP4|RS10_ORYSJ 40S ribosomal protein S10 OS=Oryza sativa subsp. japonica GN=RPS10 PE=2 SV=2 1 151 9.0E-38
sp|Q9VWG3|RS10B_DROME 40S ribosomal protein S10b OS=Drosophila melanogaster GN=RpS10b PE=1 SV=2 1 156 3.0E-37
sp|P63326|RS10_RAT 40S ribosomal protein S10 OS=Rattus norvegicus GN=Rps10 PE=2 SV=1 1 142 2.0E-36
sp|P63325|RS10_MOUSE 40S ribosomal protein S10 OS=Mus musculus GN=Rps10 PE=1 SV=1 1 142 2.0E-36
sp|Q9SW09|RS101_ARATH 40S ribosomal protein S10-1 OS=Arabidopsis thaliana GN=RPS10A PE=2 SV=1 1 151 6.0E-36
sp|P46783|RS10_HUMAN 40S ribosomal protein S10 OS=Homo sapiens GN=RPS10 PE=1 SV=1 1 142 2.0E-35
sp|Q3T0F4|RS10_BOVIN 40S ribosomal protein S10 OS=Bos taurus GN=RPS10 PE=2 SV=1 1 142 2.0E-35
sp|Q90YR4|RS10_ICTPU 40S ribosomal protein S10 OS=Ictalurus punctatus GN=rps10 PE=2 SV=1 1 139 3.0E-35
sp|Q07254|RS10_XENLA 40S ribosomal protein S10 OS=Xenopus laevis GN=rps10 PE=1 SV=1 1 139 5.0E-35
sp|Q9NQ39|RS10L_HUMAN Putative 40S ribosomal protein S10-like OS=Homo sapiens GN=RPS10P5 PE=5 SV=1 1 134 1.0E-34
sp|Q9VB14|RS10A_DROME 40S ribosomal protein S10a OS=Drosophila melanogaster GN=RpS10a PE=1 SV=1 1 157 2.0E-33
sp|Q9LTF2|RS103_ARATH 40S ribosomal protein S10-3 OS=Arabidopsis thaliana GN=RPS10C PE=2 SV=2 1 151 4.0E-32
sp|Q9FFS8|RS102_ARATH 40S ribosomal protein S10-2 OS=Arabidopsis thaliana GN=RPS10B PE=2 SV=1 1 148 3.0E-31
sp|O77082|RS10_DICDI 40S ribosomal protein S10 OS=Dictyostelium discoideum GN=rps10 PE=1 SV=3 2 150 2.0E-27
sp|P30427|PLEC_RAT Plectin OS=Rattus norvegicus GN=Plec PE=1 SV=2 1 90 1.0E-19
sp|Q9QXS1|PLEC_MOUSE Plectin OS=Mus musculus GN=Plec PE=1 SV=3 1 90 2.0E-19
sp|Q15149|PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 1 90 4.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10738
MLIPKADRKKIHEYLFREGVLVAQKDFNLPKHPDIDTKNLFVIKACQSLNSRGYVKTQFSWQYYYYTLTPEGLDY
LREWLHLPAEIVPATHIKQQRSHAPPRGMLGDGERERRPFGRGRGDRGDREGGYRRRDAGDGKEGGAPGEFAPQF
RGGFGRARGAPPS*
Coding >Hirsu2|10738
ATGTTGATTCCCAAGGCTGATCGCAAGAAGATTCACGAGTACCTCTTCCGTGAGGGCGTGCTCGTGGCTCAGAAG
GACTTCAACCTTCCTAAGCACCCCGACATCGACACAAAGAACCTCTTCGTCATCAAGGCCTGCCAGTCGCTGAAC
TCCCGCGGCTATGTCAAGACACAGTTCTCGTGGCAATACTACTACTACACCCTGACCCCCGAAGGCCTCGACTAC
CTGCGGGAATGGCTTCATCTCCCCGCCGAGATCGTACCTGCCACACATATCAAACAGCAGCGGTCGCATGCTCCT
CCTCGCGGAATGCTGGGAGACGGAGAGCGCGAGCGTAGGCCGTTTGGCCGCGGCCGCGGCGATCGCGGCGACCGC
GAAGGCGGATACAGGAGACGGGACGCTGGCGATGGCAAGGAGGGCGGTGCTCCGGGCGAGTTCGCTCCTCAATTC
CGTGGTGGCTTTGGCCGTGCTCGCGGCGCCCCCCCCTCCTAA
Transcript >Hirsu2|10738
ATGTTGATTCCCAAGGCTGATCGCAAGAAGATTCACGAGTACCTCTTCCGTGAGGGCGTGCTCGTGGCTCAGAAG
GACTTCAACCTTCCTAAGCACCCCGACATCGACACAAAGAACCTCTTCGTCATCAAGGCCTGCCAGTCGCTGAAC
TCCCGCGGCTATGTCAAGACACAGTTCTCGTGGCAATACTACTACTACACCCTGACCCCCGAAGGCCTCGACTAC
CTGCGGGAATGGCTTCATCTCCCCGCCGAGATCGTACCTGCCACACATATCAAACAGCAGCGGTCGCATGCTCCT
CCTCGCGGAATGCTGGGAGACGGAGAGCGCGAGCGTAGGCCGTTTGGCCGCGGCCGCGGCGATCGCGGCGACCGC
GAAGGCGGATACAGGAGACGGGACGCTGGCGATGGCAAGGAGGGCGGTGCTCCGGGCGAGTTCGCTCCTCAATTC
CGTGGTGGCTTTGGCCGTGCTCGCGGCGCCCCCCCCTCCTAA
Gene >Hirsu2|10738
ATGTTGATTCCCAAGGCTGATCGCAAGAAGATTCACGAGGTAATTCCAATAACGACGGCTGGGTCTTGTTTTGGT
GACTGACAGAGAGGAAGTACCTCTTCCGTGAGGGCGTGCTCGTGGCTCAGAAGGACTTCAACCTTCCTAAGCACC
CCGACATCGACACAAAGAACCTCTTCGTCATCAAGGCCTGCCAGTCGCTGAACTCCCGCGGCTATGTCAAGACAC
AGTTCTCGTGGCAATACTACTACTACACCCTGACCCCCGAAGGCCTCGACTACCTGCGGGAATGGCTTCATCTCC
CCGCCGAGATCGTACCTGCCACACATATCAAACAGCAGCGGTCGCATGCTCCTCCTCGCGGAATGCTGGGAGACG
GAGAGCGCGAGCGTAGGCCGTTTGGCCGCGGCCGCGGCGATCGCGGCGACCGCGAAGGCGGATACAGGAGACGGG
ACGCTGGCGATGGCAAGGAGGGCGGTGCTCCGGGCGAGTTCGCTCCTCAATTGTGAGGAATCCCCGACTGCTCCC
CCCAACAAAAATTTGCTGTGCGATGGTGCTAACAGCTAGATGATAGCCGTGGTGGCTTTGGCCGTGCTCGCGGCG
CCCCCCCCTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail