Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10728
Gene name
LocationContig_898:3134..4721
Strand+
Gene length (bp)1587
Transcript length (bp)1290
Coding sequence length (bp)1290
Protein length (aa) 430

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 4.8E-09 143 423

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4ATH2|CARP1_ARTBC Probable secreted aspartic protease ARB_07536 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07536 PE=1 SV=1 15 425 8.0E-101
sp|P10977|CARPV_CANAX Vacuolar aspartic protease OS=Candida albicans GN=APR1 PE=3 SV=3 84 425 1.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10728
MLFRTLAALSTLAGVAQAVPAAVPPRDADSSSVATKDSCPSRTKGVFDWPLTWDPQGFIATASVGNPRYEYKLFV
DWTWISHVVGTPKCFGQWNPSLCLAPSQPYWDPRNSTTFKNLSSVYHDRTWKPNHFFFEQPMHVEYGSDVLQIGP
VSSRAVLQLTDFAFNASQMGFVYPFTGIFGMSPVFEGDGLDYQSAFYQQWKGGAWKTGQTGFAYCYDKSKKEVCN
GQDGLQTMGGVRDDLIKGGNIWWYDVRRYPDVNELAFVYRPGMYNYWGIELESLRIGREPQKIEPTSDKSGKGAI
FDHASYGRGTPLTPNAYARLVKLTGGKPIKPKSPPNNGPQSFYSVDCARLSSFPTLRYKFSGHSREWEVTPQMYV
EKLPDGTCSLNVRALASGDKFIGNFGETFAKEKYIVLDFERNRVGIADMKWPYS*
Coding >Hirsu2|10728
ATGCTGTTCAGGACTCTCGCGGCACTATCGACGCTCGCGGGTGTGGCCCAGGCCGTGCCCGCGGCCGTGCCGCCT
CGTGACGCCGACTCCTCGTCCGTGGCTACCAAGGACAGCTGCCCGAGCCGCACCAAGGGCGTCTTCGACTGGCCG
CTCACCTGGGACCCCCAGGGCTTCATCGCCACCGCCAGCGTGGGCAACCCCCGGTACGAGTACAAGCTCTTCGTC
GACTGGACCTGGATCAGCCATGTGGTCGGAACGCCCAAGTGCTTCGGTCAGTGGAACCCGAGCCTCTGCCTGGCT
CCCAGCCAGCCCTACTGGGACCCTCGCAACTCGACCACGTTCAAGAACCTGTCTAGCGTCTACCACGATCGCACC
TGGAAGCCGAACCACTTCTTCTTCGAGCAGCCCATGCACGTCGAGTATGGGTCCGACGTCCTGCAGATCGGTCCC
GTCTCCAGCCGAGCCGTCCTGCAGCTGACCGACTTTGCCTTCAACGCCTCCCAGATGGGCTTCGTCTACCCCTTC
ACCGGCATCTTTGGCATGTCGCCGGTCTTCGAGGGCGATGGATTGGACTATCAGTCGGCCTTTTACCAGCAATGG
AAGGGCGGTGCCTGGAAGACGGGCCAGACGGGCTTCGCCTACTGCTATGACAAGTCGAAGAAGGAGGTGTGCAAT
GGCCAGGACGGCCTCCAGACCATGGGCGGCGTCCGCGACGACCTCATCAAAGGCGGCAACATCTGGTGGTACGAC
GTCAGGCGCTATCCCGACGTCAACGAGCTGGCCTTTGTGTACCGGCCCGGCATGTACAACTACTGGGGCATCGAG
CTGGAGAGCCTCCGGATCGGGCGCGAGCCGCAGAAGATCGAGCCGACGTCCGACAAGTCGGGAAAAGGCGCCATC
TTCGACCACGCCAGCTACGGCCGCGGCACGCCTCTGACCCCCAACGCCTACGCCCGCCTGGTCAAGCTGACGGGC
GGCAAGCCCATCAAGCCCAAGAGCCCGCCGAACAACGGGCCGCAGTCCTTCTACTCGGTCGACTGCGCCAGGCTG
TCCTCGTTCCCGACCCTGAGGTACAAGTTCAGCGGCCACTCGCGCGAGTGGGAGGTGACTCCCCAGATGTACGTC
GAGAAGCTGCCGGACGGCACCTGCTCGCTCAACGTGCGCGCTCTGGCAAGCGGCGACAAATTCATCGGAAATTTC
GGCGAGACGTTTGCCAAGGAAAAGTACATCGTCCTCGACTTCGAGCGCAACCGCGTCGGCATCGCCGACATGAAG
TGGCCTTACTCGTGA
Transcript >Hirsu2|10728
ATGCTGTTCAGGACTCTCGCGGCACTATCGACGCTCGCGGGTGTGGCCCAGGCCGTGCCCGCGGCCGTGCCGCCT
CGTGACGCCGACTCCTCGTCCGTGGCTACCAAGGACAGCTGCCCGAGCCGCACCAAGGGCGTCTTCGACTGGCCG
CTCACCTGGGACCCCCAGGGCTTCATCGCCACCGCCAGCGTGGGCAACCCCCGGTACGAGTACAAGCTCTTCGTC
GACTGGACCTGGATCAGCCATGTGGTCGGAACGCCCAAGTGCTTCGGTCAGTGGAACCCGAGCCTCTGCCTGGCT
CCCAGCCAGCCCTACTGGGACCCTCGCAACTCGACCACGTTCAAGAACCTGTCTAGCGTCTACCACGATCGCACC
TGGAAGCCGAACCACTTCTTCTTCGAGCAGCCCATGCACGTCGAGTATGGGTCCGACGTCCTGCAGATCGGTCCC
GTCTCCAGCCGAGCCGTCCTGCAGCTGACCGACTTTGCCTTCAACGCCTCCCAGATGGGCTTCGTCTACCCCTTC
ACCGGCATCTTTGGCATGTCGCCGGTCTTCGAGGGCGATGGATTGGACTATCAGTCGGCCTTTTACCAGCAATGG
AAGGGCGGTGCCTGGAAGACGGGCCAGACGGGCTTCGCCTACTGCTATGACAAGTCGAAGAAGGAGGTGTGCAAT
GGCCAGGACGGCCTCCAGACCATGGGCGGCGTCCGCGACGACCTCATCAAAGGCGGCAACATCTGGTGGTACGAC
GTCAGGCGCTATCCCGACGTCAACGAGCTGGCCTTTGTGTACCGGCCCGGCATGTACAACTACTGGGGCATCGAG
CTGGAGAGCCTCCGGATCGGGCGCGAGCCGCAGAAGATCGAGCCGACGTCCGACAAGTCGGGAAAAGGCGCCATC
TTCGACCACGCCAGCTACGGCCGCGGCACGCCTCTGACCCCCAACGCCTACGCCCGCCTGGTCAAGCTGACGGGC
GGCAAGCCCATCAAGCCCAAGAGCCCGCCGAACAACGGGCCGCAGTCCTTCTACTCGGTCGACTGCGCCAGGCTG
TCCTCGTTCCCGACCCTGAGGTACAAGTTCAGCGGCCACTCGCGCGAGTGGGAGGTGACTCCCCAGATGTACGTC
GAGAAGCTGCCGGACGGCACCTGCTCGCTCAACGTGCGCGCTCTGGCAAGCGGCGACAAATTCATCGGAAATTTC
GGCGAGACGTTTGCCAAGGAAAAGTACATCGTCCTCGACTTCGAGCGCAACCGCGTCGGCATCGCCGACATGAAG
TGGCCTTACTCGTGA
Gene >Hirsu2|10728
ATGCTGTTCAGGACTCTCGCGGCACTATCGACGCTCGCGGGTGTGGCCCAGGCCGTGCCCGCGGCCGTGCCGCCT
CGTGACGCCGACTCCTCGTCCGTGGCTACCAAGGACAGCTGCCCGAGCCGCACCAAGGGCGTCTTCGACTGGCCG
CTCACCTGGGACCCCCAGGGCTTCATCGCCACCGCCAGCGTGGGCAACCCCCGGTACGAGTACAAGCTCTTCGTC
GACTGGACCTGGATCAGCCATGTGGTCGGAACGCCCAAGTGCTTCGGTCAGTGGAACCCGAGCCTCTGCCTGGCT
CCCAGCCAGCCCTACTGGGACCCTCGCAACTCGACCACGTTCAAGAACCTGTCTAGCGTCTACCACGATCGCACC
TGGAAGCCGAACCACTTCTTCTTCGAGCAGCCCATGCACGTCGAGTATGGGTCCGACGTCCTGCAGATCGGTCCC
GTCTCCAGCCGAGCCGTCCTGCAGCTGACCGACTTTGCCTTCAACGCCTCCCAGATGGGCTTCGTCTACCCCTTC
ACCGGCATCTTTGGCATGTCGCCGGTCTTCGAGGGCGATGGATGTGAGTGGCCGCACCCGCACCGCACCACTGCG
CCCCTCTCGTATCCATCCGCCTTGAGCCGCTCGGCCGCGGAGGCTTGCTGCTGACGGGGACGCTGCAGTGGACTA
TCAGTCGGCCTTTTACCAGCAATGGAAGGGCGGTGCCTGGAAGACGGGCCAGACGGGCTTCGCCTACTGCTATGA
CAAGTCGAAGAAGGAGGTGTGCAATGGCCAGGACGGCCTCCAGACCATGGGCGGCGTCCGCGACGACCTCATCAA
AGGCGGCAACATCTGGTGGTACGACGTCAGGCGCTATCCCGACGTCAACGAGCTGGCCTTTGTGTACCGGCCCGG
CATGTACAACTACTGGGGCATCGAGCTGGAGAGCCTCCGGATCGGGCGCGAGCCGCAGAAGATCGAGCCGACGTC
CGACAAGTCGGGAAAAGGCGCCATCTTCGACCACGCCAGCTACGGCCGCGGCACGCCTCTGACCCCCAACGCCTA
CGCCCGCCTGGTCAAGCTGACGGGCGGCAAGCCCATCAAGCCCAAGAGCCCGCCGAACAACGGGCCGCAGTCCTT
CTACTCGGTCGACTGCGCCAGGCTGTCCTCGTTCCCGACCCTGAGGTACAAGTTCAGCGGCCACTCGCGCGAGTG
GGAGGTGACTCCCCAGATGTACGTCGAGAAGCTGCCGGACGGCACCTGCTCGCTCAACGTGCGCGCTCTGGCAAG
CGGCGACAAATTGTGAGTGACAGACGGGCCGACGACGACAAGTCCAAGCCCACCCTCGGAGTCGCAGGCAGAGGC
TTGGAGAAGGGCTGAGGCTGACCGCGGGGGCTGAAATGCACAGCATCGGAAATTTCGGCGAGACGTTTGCCAAGG
AAAAGTACATCGTCCTCGACTTCGAGCGCAACCGCGTCGGCATCGCCGACATGAAGTGGTAAGTGGTGTCCTGAA
TGGCGACAGAAGTCCGTGCAGCAAGGAGACGGATCCCTGCCGTGGTCGCGGCTGACCATTCCGTCCTCCCTCAGG
CCTTACTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail