Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10723
Gene name
LocationContig_897:2720..4516
Strand-
Gene length (bp)1796
Transcript length (bp)1734
Coding sequence length (bp)1734
Protein length (aa) 578

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01384 PHO4 Phosphate transporter family 3.3E-113 25 564

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15710|PHO4_NEUCR Phosphate-repressible phosphate permease pho-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-4 PE=1 SV=1 4 577 0.0E+00
sp|P38361|PHO89_YEAST Phosphate permease PHO89 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO89 PE=1 SV=1 3 577 2.0E-138
sp|Q5BL44|S20A1_XENTR Sodium-dependent phosphate transporter 1 OS=Xenopus tropicalis GN=slc20a1 PE=2 SV=1 385 574 2.0E-41
sp|Q6PB26|S20AB_XENLA Sodium-dependent phosphate transporter 1-B OS=Xenopus laevis GN=slc20a1-b PE=2 SV=1 374 574 3.0E-41
sp|Q68F35|S20AA_XENLA Sodium-dependent phosphate transporter 1-A OS=Xenopus laevis GN=slc20a1-a PE=2 SV=1 384 574 3.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15710|PHO4_NEUCR Phosphate-repressible phosphate permease pho-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pho-4 PE=1 SV=1 4 577 0.0E+00
sp|P38361|PHO89_YEAST Phosphate permease PHO89 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO89 PE=1 SV=1 3 577 2.0E-138
sp|Q5BL44|S20A1_XENTR Sodium-dependent phosphate transporter 1 OS=Xenopus tropicalis GN=slc20a1 PE=2 SV=1 385 574 2.0E-41
sp|Q6PB26|S20AB_XENLA Sodium-dependent phosphate transporter 1-B OS=Xenopus laevis GN=slc20a1-b PE=2 SV=1 374 574 3.0E-41
sp|Q68F35|S20AA_XENLA Sodium-dependent phosphate transporter 1-A OS=Xenopus laevis GN=slc20a1-a PE=2 SV=1 384 574 3.0E-41
sp|O97596|S20A1_FELCA Sodium-dependent phosphate transporter 1 OS=Felis catus GN=Slc20a1 PE=2 SV=2 407 573 3.0E-40
sp|Q5R9L5|S20A1_PONAB Sodium-dependent phosphate transporter 1 OS=Pongo abelii GN=SLC20A1 PE=2 SV=1 407 573 5.0E-40
sp|Q8WUM9|S20A1_HUMAN Sodium-dependent phosphate transporter 1 OS=Homo sapiens GN=SLC20A1 PE=1 SV=1 407 573 8.0E-40
sp|Q61609|S20A1_MOUSE Sodium-dependent phosphate transporter 1 OS=Mus musculus GN=Slc20a1 PE=1 SV=1 407 573 3.0E-39
sp|Q9JJP0|S20A1_RAT Sodium-dependent phosphate transporter 1 OS=Rattus norvegicus GN=Slc20a1 PE=1 SV=1 407 573 1.0E-38
sp|Q6NV12|S20AA_DANRE Sodium-dependent phosphate transporter 1-A OS=Danio rerio GN=slc20a1a PE=2 SV=1 386 573 1.0E-38
sp|Q6PFM1|S20AB_DANRE Sodium-dependent phosphate transporter 1-B OS=Danio rerio GN=slc20a1b PE=2 SV=1 371 573 2.0E-38
sp|Q63488|S20A2_RAT Sodium-dependent phosphate transporter 2 OS=Rattus norvegicus GN=Slc20a2 PE=1 SV=1 400 573 7.0E-38
sp|Q9UYV6|Y1401_PYRAB Putative phosphate permease PYRAB14010 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB14010 PE=3 SV=1 408 571 1.0E-37
sp|Q5XHF9|S20A2_XENLA Sodium-dependent phosphate transporter 2 OS=Xenopus laevis GN=slc20a2 PE=2 SV=1 400 573 1.0E-37
sp|Q08357|S20A2_HUMAN Sodium-dependent phosphate transporter 2 OS=Homo sapiens GN=SLC20A2 PE=1 SV=1 409 573 2.0E-37
sp|Q80UP8|S20A2_MOUSE Sodium-dependent phosphate transporter 2 OS=Mus musculus GN=Slc20a2 PE=1 SV=2 407 573 2.0E-37
sp|Q28E01|S20A2_XENTR Sodium-dependent phosphate transporter 2 OS=Xenopus tropicalis GN=slc20a2 PE=2 SV=1 400 573 2.0E-37
sp|Q95L97|S20A2_FELCA Sodium-dependent phosphate transporter 2 OS=Felis catus GN=SLC20A2 PE=1 SV=1 375 573 4.0E-37
sp|A1A4I1|S20A2_BOVIN Sodium-dependent phosphate transporter 2 OS=Bos taurus GN=SLC20A2 PE=2 SV=1 398 573 5.0E-37
sp|O58374|Y640_PYRHO Putative phosphate permease PH0640 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0640 PE=3 SV=1 408 572 5.0E-37
sp|Q9ES44|S20A2_CRIGR Sodium-dependent phosphate transporter 2 OS=Cricetulus griseus GN=SLC20A2 PE=1 SV=2 407 573 2.0E-36
sp|Q8U230|Y1020_PYRFU Putative phosphate permease PF1020 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1020 PE=3 SV=1 408 569 6.0E-36
sp|O28476|Y1798_ARCFU Putative phosphate permease AF_1798 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1798 PE=3 SV=1 403 572 9.0E-32
sp|Q9Z7M4|Y680_CHLPN Putative phosphate permease CPn_0680/CP_0067/CPj0680/CpB0707 OS=Chlamydia pneumoniae GN=CPn_0680 PE=3 SV=1 386 564 2.0E-30
sp|A1A4I1|S20A2_BOVIN Sodium-dependent phosphate transporter 2 OS=Bos taurus GN=SLC20A2 PE=2 SV=1 3 254 1.0E-29
sp|Q5JHX4|Y2061_THEKO Putative phosphate permease TK2061 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK2061 PE=3 SV=1 409 572 2.0E-29
sp|Q63488|S20A2_RAT Sodium-dependent phosphate transporter 2 OS=Rattus norvegicus GN=Slc20a2 PE=1 SV=1 3 254 3.0E-29
sp|Q28E01|S20A2_XENTR Sodium-dependent phosphate transporter 2 OS=Xenopus tropicalis GN=slc20a2 PE=2 SV=1 4 254 3.0E-29
sp|Q80UP8|S20A2_MOUSE Sodium-dependent phosphate transporter 2 OS=Mus musculus GN=Slc20a2 PE=1 SV=2 3 254 4.0E-29
sp|Q6PFM1|S20AB_DANRE Sodium-dependent phosphate transporter 1-B OS=Danio rerio GN=slc20a1b PE=2 SV=1 4 329 5.0E-29
sp|Q6PB26|S20AB_XENLA Sodium-dependent phosphate transporter 1-B OS=Xenopus laevis GN=slc20a1-b PE=2 SV=1 7 215 6.0E-29
sp|Q95L97|S20A2_FELCA Sodium-dependent phosphate transporter 2 OS=Felis catus GN=SLC20A2 PE=1 SV=1 3 254 1.0E-28
sp|Q68F35|S20AA_XENLA Sodium-dependent phosphate transporter 1-A OS=Xenopus laevis GN=slc20a1-a PE=2 SV=1 7 215 2.0E-28
sp|Q08357|S20A2_HUMAN Sodium-dependent phosphate transporter 2 OS=Homo sapiens GN=SLC20A2 PE=1 SV=1 3 254 2.0E-28
sp|Q5XHF9|S20A2_XENLA Sodium-dependent phosphate transporter 2 OS=Xenopus laevis GN=slc20a2 PE=2 SV=1 4 254 3.0E-28
sp|P65713|Y2302_MYCBO Putative phosphate permease Mb2302 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2302 PE=3 SV=1 406 566 4.0E-28
sp|P9WIA5|Y2281_MYCTU Putative phosphate permease Rv2281 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2281 PE=3 SV=1 406 566 4.0E-28
sp|P9WIA4|Y2281_MYCTO Putative phosphate permease MT2339 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2339 PE=3 SV=1 406 566 4.0E-28
sp|Q9ES44|S20A2_CRIGR Sodium-dependent phosphate transporter 2 OS=Cricetulus griseus GN=SLC20A2 PE=1 SV=2 3 254 1.0E-27
sp|O97596|S20A1_FELCA Sodium-dependent phosphate transporter 1 OS=Felis catus GN=Slc20a1 PE=2 SV=2 4 254 2.0E-27
sp|Q6NV12|S20AA_DANRE Sodium-dependent phosphate transporter 1-A OS=Danio rerio GN=slc20a1a PE=2 SV=1 9 215 2.0E-27
sp|Q5BL44|S20A1_XENTR Sodium-dependent phosphate transporter 1 OS=Xenopus tropicalis GN=slc20a1 PE=2 SV=1 4 254 5.0E-27
sp|Q5R9L5|S20A1_PONAB Sodium-dependent phosphate transporter 1 OS=Pongo abelii GN=SLC20A1 PE=2 SV=1 4 215 2.0E-26
sp|Q8WUM9|S20A1_HUMAN Sodium-dependent phosphate transporter 1 OS=Homo sapiens GN=SLC20A1 PE=1 SV=1 4 254 2.0E-26
sp|Q61609|S20A1_MOUSE Sodium-dependent phosphate transporter 1 OS=Mus musculus GN=Slc20a1 PE=1 SV=1 6 254 2.0E-26
sp|Q9JJP0|S20A1_RAT Sodium-dependent phosphate transporter 1 OS=Rattus norvegicus GN=Slc20a1 PE=1 SV=1 6 254 2.0E-26
sp|O84698|Y962_CHLTR Putative phosphate permease CT_962 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_692 PE=3 SV=1 359 564 1.0E-25
sp|P45268|Y1604_HAEIN Putative phosphate permease HI_1604 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1604 PE=3 SV=1 409 571 8.0E-25
sp|Q9ZJC8|YE91_HELPJ Putative phosphate permease jhp_1384 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=jhp_1384 PE=3 SV=1 400 549 1.0E-24
sp|O26024|Y1491_HELPY Putative phosphate permease HP_1491 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_1491 PE=3 SV=1 400 549 2.0E-24
sp|Q38954|PHT21_ARATH Inorganic phosphate transporter 2-1, chloroplastic OS=Arabidopsis thaliana GN=PHT2-1 PE=1 SV=1 411 566 2.0E-24
sp|P45268|Y1604_HAEIN Putative phosphate permease HI_1604 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1604 PE=3 SV=1 1 226 1.0E-21
sp|O28476|Y1798_ARCFU Putative phosphate permease AF_1798 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1798 PE=3 SV=1 8 189 2.0E-21
sp|Q9UYV6|Y1401_PYRAB Putative phosphate permease PYRAB14010 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB14010 PE=3 SV=1 22 188 8.0E-21
sp|Q38954|PHT21_ARATH Inorganic phosphate transporter 2-1, chloroplastic OS=Arabidopsis thaliana GN=PHT2-1 PE=1 SV=1 16 168 5.0E-20
sp|Q9Z7M4|Y680_CHLPN Putative phosphate permease CPn_0680/CP_0067/CPj0680/CpB0707 OS=Chlamydia pneumoniae GN=CPn_0680 PE=3 SV=1 19 211 1.0E-19
sp|O84698|Y962_CHLTR Putative phosphate permease CT_962 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=CT_692 PE=3 SV=1 19 198 6.0E-19
sp|Q9PLN5|Y064_CHLMU Putative phosphate permease TC_0064 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0064 PE=3 SV=1 19 198 2.0E-18
sp|O30499|PIT_RHIME Probable low-affinity inorganic phosphate transporter OS=Rhizobium meliloti (strain 1021) GN=pit PE=3 SV=1 412 566 4.0E-18
sp|Q8U230|Y1020_PYRFU Putative phosphate permease PF1020 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1020 PE=3 SV=1 8 207 1.0E-17
sp|Q5JHX4|Y2061_THEKO Putative phosphate permease TK2061 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK2061 PE=3 SV=1 22 207 1.0E-17
sp|P65713|Y2302_MYCBO Putative phosphate permease Mb2302 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2302 PE=3 SV=1 10 193 3.0E-17
sp|P9WIA5|Y2281_MYCTU Putative phosphate permease Rv2281 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2281 PE=3 SV=1 10 193 3.0E-17
sp|P9WIA4|Y2281_MYCTO Putative phosphate permease MT2339 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2339 PE=3 SV=1 10 193 3.0E-17
sp|O58374|Y640_PYRHO Putative phosphate permease PH0640 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0640 PE=3 SV=1 16 209 4.0E-17
sp|Q9PLN5|Y064_CHLMU Putative phosphate permease TC_0064 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=TC_0064 PE=3 SV=1 409 564 2.0E-15
sp|O34436|PIT_BACSU Probable low-affinity inorganic phosphate transporter OS=Bacillus subtilis (strain 168) GN=pit PE=3 SV=2 415 566 8.0E-14
sp|Q9ZJC8|YE91_HELPJ Putative phosphate permease jhp_1384 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=jhp_1384 PE=3 SV=1 22 202 1.0E-11
sp|O26024|Y1491_HELPY Putative phosphate permease HP_1491 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_1491 PE=3 SV=1 22 265 4.0E-11
sp|P9WIA7|PIT_MYCTU Probable low-affinity inorganic phosphate transporter OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pit PE=3 SV=1 405 563 2.0E-10
sp|P9WIA6|PIT_MYCTO Probable low-affinity inorganic phosphate transporter OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pit PE=3 SV=1 405 563 3.0E-10
sp|P59950|PIT_MYCBO Probable low-affinity inorganic phosphate transporter OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pit PE=3 SV=1 405 563 3.0E-10
sp|Q50173|PIT_MYCLE Probable low-affinity inorganic phosphate transporter OS=Mycobacterium leprae (strain TN) GN=pit PE=3 SV=1 416 561 6.0E-10
sp|Q9ES44|S20A2_CRIGR Sodium-dependent phosphate transporter 2 OS=Cricetulus griseus GN=SLC20A2 PE=1 SV=2 424 571 1.0E-06
sp|Q5XHF9|S20A2_XENLA Sodium-dependent phosphate transporter 2 OS=Xenopus laevis GN=slc20a2 PE=2 SV=1 424 573 4.0E-06
sp|Q08357|S20A2_HUMAN Sodium-dependent phosphate transporter 2 OS=Homo sapiens GN=SLC20A2 PE=1 SV=1 409 571 4.0E-06
sp|Q95L97|S20A2_FELCA Sodium-dependent phosphate transporter 2 OS=Felis catus GN=SLC20A2 PE=1 SV=1 424 571 4.0E-06
sp|Q58047|Y630_METJA Putative phosphate permease MJ0630 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0630 PE=3 SV=1 414 555 6.0E-06
sp|Q63488|S20A2_RAT Sodium-dependent phosphate transporter 2 OS=Rattus norvegicus GN=Slc20a2 PE=1 SV=1 424 571 6.0E-06
sp|Q80UP8|S20A2_MOUSE Sodium-dependent phosphate transporter 2 OS=Mus musculus GN=Slc20a2 PE=1 SV=2 424 571 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006817 phosphate ion transport Yes
GO:0005315 inorganic phosphate transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0022804 active transmembrane transporter activity No
GO:0008150 biological_process No
GO:0015698 inorganic anion transport No
GO:0006820 anion transport No
GO:0006811 ion transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0006810 transport No
GO:0015291 secondary active transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 7 25 18
2 45 67 22
3 87 109 22
4 156 178 22
5 191 213 22
6 228 250 22
7 410 429 19
8 460 482 22
9 549 571 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10723
MAALQQYDYLFAVGTVFAFLDAWNIGANDVANSWASSVSSRSVSYLQAMLGASVMEFGGALGVGGRVADTIRTKV
VDVGAFEGRPEVLMLGMVCAVVASSCYLTAATRLGMPVSTTHSILGAVLGMGVAALGRRGVTWVGRHPDGSVDIG
QGVVQVFLAWVIAPLLSAAFGAVIFLLTKYGVLLRSRPAVRGLVLVPFYFWLAASLIVMLLIWKGGDYAVDLRDA
QIPGVIVAAGAAWGLLMALFLVPWLYRVVVLDDWQLRAWHVLQGPWLLRRGPVPPPPADFGGVVRNFYEGHLTRD
ELDARRARFAAADDVEGRSADAGPAKDKAASASDRTDDEPEPRPQPKSLVGPKPDGPWYSRAFVWWFVKWLVLRG
VDQDVVGSQTKKSVLAGDVEEIHARASRFDNRAEFLYTFLQVMTAAAASFTHGANDVANAVGPYASIYQIWRTAE
IPGSKANVPLWILAFGGAGIVIGLWTYGYHIMRNLGNRVTLMSPSRGFSMELGSVITVIMATRLKLPVSTTQCIT
GSIVGVGLCNGDWRAINWRMVAWIYLGWFITVPAAGLLSGILMSVIVYSPHW*
Coding >Hirsu2|10723
ATGGCGGCCCTCCAGCAGTATGACTACCTCTTCGCCGTCGGCACCGTCTTCGCCTTCCTCGACGCCTGGAACATC
GGGGCCAACGACGTGGCCAACTCGTGGGCCAGCTCGGTGTCATCGCGGTCCGTGTCGTACCTGCAGGCGATGCTG
GGCGCGTCCGTGATGGAGTTCGGCGGCGCGCTCGGCGTCGGCGGCCGCGTGGCCGACACGATCCGCACCAAGGTC
GTCGACGTCGGCGCCTTCGAGGGCCGGCCCGAGGTGCTGATGCTCGGCATGGTCTGCGCCGTCGTCGCCTCGTCC
TGCTACCTGACGGCCGCCACCCGGCTCGGCATGCCCGTCTCGACCACCCACTCCATCCTCGGGGCCGTCCTCGGC
ATGGGCGTCGCCGCTCTTGGCCGCCGCGGCGTCACCTGGGTCGGCCGCCACCCGGACGGCTCCGTCGACATCGGC
CAGGGCGTCGTCCAGGTCTTCCTGGCCTGGGTCATCGCCCCGCTGCTGTCGGCCGCCTTCGGCGCCGTCATCTTT
CTGCTGACCAAGTACGGCGTCCTGCTGCGGTCCAGGCCGGCCGTCCGCGGCCTCGTCCTCGTCCCCTTTTACTTC
TGGCTGGCCGCCTCGCTCATCGTCATGCTGCTCATCTGGAAGGGCGGCGACTACGCCGTCGACCTGCGCGACGCC
CAGATCCCCGGCGTCATCGTCGCCGCCGGCGCTGCCTGGGGCCTGCTCATGGCCCTGTTCCTCGTTCCCTGGCTC
TACCGCGTCGTCGTCCTCGACGACTGGCAGCTGCGCGCCTGGCACGTCCTGCAGGGCCCGTGGCTGCTCCGCCGA
GGCCCCGTGCCGCCGCCTCCCGCCGACTTCGGCGGCGTCGTCCGCAACTTCTATGAGGGCCACCTGACGCGCGAC
GAGCTCGACGCCCGCCGCGCCCGCTTCGCCGCCGCCGACGACGTCGAGGGCCGGAGCGCCGACGCCGGACCGGCC
AAGGACAAGGCCGCCTCCGCCTCGGACCGCACCGACGACGAGCCCGAGCCCCGGCCGCAGCCCAAGTCGCTCGTC
GGCCCCAAGCCCGACGGCCCCTGGTACTCGCGCGCCTTCGTCTGGTGGTTCGTCAAGTGGCTCGTCCTGCGCGGC
GTCGACCAAGACGTCGTCGGCTCCCAGACCAAGAAGTCGGTCCTGGCCGGCGACGTCGAGGAGATCCATGCCCGC
GCCAGCCGCTTCGACAACCGCGCCGAGTTCCTCTACACCTTTCTCCAGGTCATGACCGCCGCCGCCGCCTCCTTC
ACCCACGGCGCCAACGACGTCGCCAACGCTGTCGGCCCCTATGCCTCCATCTATCAGATCTGGCGCACCGCCGAG
ATCCCCGGCTCCAAGGCCAACGTGCCTCTGTGGATCCTCGCCTTCGGCGGTGCCGGCATCGTCATCGGCCTCTGG
ACCTACGGCTACCACATCATGCGCAACCTCGGCAACCGCGTCACCCTCATGTCTCCCTCCCGGGGCTTCTCCATG
GAGCTGGGCTCCGTCATCACCGTCATCATGGCCACTCGCCTCAAGCTGCCCGTATCCACCACGCAGTGCATAACG
GGCTCCATCGTCGGCGTCGGCCTCTGCAACGGCGACTGGCGTGCCATAAACTGGCGCATGGTGGCCTGGATCTAT
CTCGGCTGGTTCATCACCGTCCCCGCCGCCGGCCTCCTCTCCGGAATACTCATGAGCGTCATCGTCTACTCTCCT
CACTGGTGA
Transcript >Hirsu2|10723
ATGGCGGCCCTCCAGCAGTATGACTACCTCTTCGCCGTCGGCACCGTCTTCGCCTTCCTCGACGCCTGGAACATC
GGGGCCAACGACGTGGCCAACTCGTGGGCCAGCTCGGTGTCATCGCGGTCCGTGTCGTACCTGCAGGCGATGCTG
GGCGCGTCCGTGATGGAGTTCGGCGGCGCGCTCGGCGTCGGCGGCCGCGTGGCCGACACGATCCGCACCAAGGTC
GTCGACGTCGGCGCCTTCGAGGGCCGGCCCGAGGTGCTGATGCTCGGCATGGTCTGCGCCGTCGTCGCCTCGTCC
TGCTACCTGACGGCCGCCACCCGGCTCGGCATGCCCGTCTCGACCACCCACTCCATCCTCGGGGCCGTCCTCGGC
ATGGGCGTCGCCGCTCTTGGCCGCCGCGGCGTCACCTGGGTCGGCCGCCACCCGGACGGCTCCGTCGACATCGGC
CAGGGCGTCGTCCAGGTCTTCCTGGCCTGGGTCATCGCCCCGCTGCTGTCGGCCGCCTTCGGCGCCGTCATCTTT
CTGCTGACCAAGTACGGCGTCCTGCTGCGGTCCAGGCCGGCCGTCCGCGGCCTCGTCCTCGTCCCCTTTTACTTC
TGGCTGGCCGCCTCGCTCATCGTCATGCTGCTCATCTGGAAGGGCGGCGACTACGCCGTCGACCTGCGCGACGCC
CAGATCCCCGGCGTCATCGTCGCCGCCGGCGCTGCCTGGGGCCTGCTCATGGCCCTGTTCCTCGTTCCCTGGCTC
TACCGCGTCGTCGTCCTCGACGACTGGCAGCTGCGCGCCTGGCACGTCCTGCAGGGCCCGTGGCTGCTCCGCCGA
GGCCCCGTGCCGCCGCCTCCCGCCGACTTCGGCGGCGTCGTCCGCAACTTCTATGAGGGCCACCTGACGCGCGAC
GAGCTCGACGCCCGCCGCGCCCGCTTCGCCGCCGCCGACGACGTCGAGGGCCGGAGCGCCGACGCCGGACCGGCC
AAGGACAAGGCCGCCTCCGCCTCGGACCGCACCGACGACGAGCCCGAGCCCCGGCCGCAGCCCAAGTCGCTCGTC
GGCCCCAAGCCCGACGGCCCCTGGTACTCGCGCGCCTTCGTCTGGTGGTTCGTCAAGTGGCTCGTCCTGCGCGGC
GTCGACCAAGACGTCGTCGGCTCCCAGACCAAGAAGTCGGTCCTGGCCGGCGACGTCGAGGAGATCCATGCCCGC
GCCAGCCGCTTCGACAACCGCGCCGAGTTCCTCTACACCTTTCTCCAGGTCATGACCGCCGCCGCCGCCTCCTTC
ACCCACGGCGCCAACGACGTCGCCAACGCTGTCGGCCCCTATGCCTCCATCTATCAGATCTGGCGCACCGCCGAG
ATCCCCGGCTCCAAGGCCAACGTGCCTCTGTGGATCCTCGCCTTCGGCGGTGCCGGCATCGTCATCGGCCTCTGG
ACCTACGGCTACCACATCATGCGCAACCTCGGCAACCGCGTCACCCTCATGTCTCCCTCCCGGGGCTTCTCCATG
GAGCTGGGCTCCGTCATCACCGTCATCATGGCCACTCGCCTCAAGCTGCCCGTATCCACCACGCAGTGCATAACG
GGCTCCATCGTCGGCGTCGGCCTCTGCAACGGCGACTGGCGTGCCATAAACTGGCGCATGGTGGCCTGGATCTAT
CTCGGCTGGTTCATCACCGTCCCCGCCGCCGGCCTCCTCTCCGGAATACTCATGAGCGTCATCGTCTACTCTCCT
CACTGGTGA
Gene >Hirsu2|10723
ATGGCGGCCCTCCAGCAGTATGACTACCTCTTCGCCGTCGGCACCGTCTTCGCCTTCCTCGACGCCTGGAACATC
GGGGCCAACGACGTGGCCAACTCGTGGGCCAGCTCGGTGTCATCGCGGTCCGTGTCGTACCTGCAGGCGATGCTG
GGCGCGTCCGTGATGGAGTTCGGCGGCGCGCTCGGCGTCGGCGGCCGCGTGGCCGACACGATCCGCACCAAGGTC
GTCGACGTCGGCGCCTTCGAGGGCCGGCCCGAGGTGCTGATGCTCGGCATGGTCTGCGCCGTCGTCGCCTCGTCC
TGCTACCTGACGGCCGCCACCCGGCTCGGCATGCCCGTCTCGACCACCCACTCCATCCTCGGGGCCGTCCTCGGC
ATGGGCGTCGCCGCTCTTGGCCGCCGCGGCGTCACCTGGGTCGGCCGCCACCCGGACGGCTCCGTCGACATCGGC
CAGGGCGTCGTCCAGGTCTTCCTGGCCTGGGTCATCGCCCCGCTGCTGTCGGCCGCCTTCGGCGCCGTCATCTTT
CTGCTGACCAAGTACGGCGTCCTGCTGCGGTCCAGGCCGGCCGTCCGCGGCCTCGTCCTCGTCCCCTTTTACTTC
TGGCTGGCCGCCTCGCTCATCGTCATGCTGCTCATCTGGAAGGGCGGCGACTACGCCGTCGACCTGCGCGACGCC
CAGATCCCCGGCGTCATCGTCGCCGCCGGCGCTGCCTGGGGCCTGCTCATGGCCCTGTTCCTCGTTCCCTGGCTC
TACCGCGTCGTCGTCCTCGACGACTGGCAGCTGCGCGCCTGGCACGTCCTGCAGGGCCCGTGGCTGCTCCGCCGA
GGCCCCGTGCCGCCGCCTCCCGCCGACTTCGGCGGCGTCGTCCGCAACTTCTATGAGGGCCACCTGACGCGCGAC
GAGCTCGACGCCCGCCGCGCCCGCTTCGCCGCCGCCGACGACGTCGAGGGCCGGAGCGCCGACGCCGGACCGGCC
AAGGACAAGGCCGCCTCCGCCTCGGACCGCACCGACGACGAGCCCGAGCCCCGGCCGCAGCCCAAGTCGCTCGTC
GGCCCCAAGCCCGACGGCCCCTGGTACTCGCGCGCCTTCGTCTGGTGGTTCGTCAAGTGGCTCGTCCTGCGCGGC
GTCGACCAAGACGTCGTCGGCTCCCAGACCAAGAAGTCGGTCCTGGCCGGCGACGTCGAGGAGATCCATGCCCGC
GCCAGCCGCTTCGACAACCGCGCCGAGTTCCTCTACACCTTTCTCCAGGTCATGACCGCCGCCGCCGCCTCCTTC
ACCCACGGCGCCAACGACGTCGCCAACGCTGTCGGCCCCTATGCCTCCATCTATCAGATCTGGCGCACCGCCGAG
ATCCCCGGCTCCAAGGCCAACGTGCCTCTGTGGATCCTCGCCTTCGGCGGTGCCGGCATCGTCATCGGCCTCTGG
ACCTACGGCTACCACATCATGCGCAACCTCGGCAACCGCGTCACCCTCATGTCTCCCTCCCGGGGCTTCTCCATG
GAGCTGGGCTCCGTCATCACCGTCATCATGGCCACTCGCCTCAGTAAGAATCCCTTCTCCTGCTGCCTTCTTGGA
ACCTCTGCTGACCTGCCCCGCCTTGATTAGAGCTGCCCGTATCCACCACGCAGTGCATAACGGGCTCCATCGTCG
GCGTCGGCCTCTGCAACGGCGACTGGCGTGCCATAAACTGGCGCATGGTGGCCTGGATCTATCTCGGCTGGTTCA
TCACCGTCCCCGCCGCCGGCCTCCTCTCCGGAATACTCATGAGCGTCATCGTCTACTCTCCTCACTGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail