Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10715
Gene name
LocationContig_895:7236..8425
Strand+
Gene length (bp)1189
Transcript length (bp)1074
Coding sequence length (bp)1074
Protein length (aa) 358

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 1.9E-09 23 73
PF04193 PQ-loop PQ loop repeat 1.5E-13 175 228

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14166|YDX3_SCHPO Uncharacterized protein C4C5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4C5.03 PE=4 SV=1 21 265 2.0E-32

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1765 0.054 0.0629 0.1971 0.2444 0.0073 0.3311 0.7735 0.4148 0.1032

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 20 38 18
2 51 73 22
3 97 119 22
4 145 167 22
5 172 191 19
6 203 225 22
7 235 257 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4827
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5267
Ophiocordyceps australis map64 (Brazil) OphauB2|4650
Ophiocordyceps camponoti-floridani Ophcf2|02865
Ophiocordyceps camponoti-rufipedis Ophun1|3567
Ophiocordyceps kimflemingae Ophio5|1428
Ophiocordyceps subramaniannii Hirsu2|10715 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10715
MDFEALAQAECERLKSPSYLELIVSVLILVGLLISYLPQHYRIISRGTSEGISPYFVLLGTTSATAGFANILTVP
PSRAAIGCCKELGTFECAAGLLGVAQLGVQWLCFTLILVLFLIFFRYREANVPQEELGGESPKWQVAVMVGLVCL
LHGLAVVIVTGVFAIAVPSHLTAWANVLGVMAAVLAAIQYVPQIWMTYHLKHVGSLSIPMMCIQTPGGFLFAASL
FARLGPAGWSTWVIYLMTAVMQGTVLALGVYYEIAARRHEGHGVEYPASVPHSPLERSGFPRRPSASRTYSEGWE
RGLPGPFTGHPERYAETEEDLDHMQEREERAIARENQPLLRPGGIGNPRRNYDSSRS*
Coding >Hirsu2|10715
ATGGACTTCGAGGCGCTGGCCCAGGCCGAGTGCGAGCGGCTCAAGTCGCCCTCGTACCTCGAGCTCATCGTCTCC
GTACTGATCCTCGTCGGACTGCTGATATCGTACCTGCCGCAACACTACCGCATCATCTCCAGGGGCACCTCGGAG
GGCATCTCGCCCTACTTCGTCCTCCTCGGAACGACGTCGGCCACGGCCGGCTTCGCCAACATCCTCACCGTCCCG
CCGTCGCGCGCCGCCATCGGCTGCTGCAAGGAGCTGGGCACCTTTGAGTGCGCCGCCGGATTGCTGGGCGTCGCC
CAGCTCGGCGTGCAGTGGCTGTGCTTCACCCTCATCCTCGTCCTCTTCCTCATCTTCTTCCGCTACCGCGAGGCC
AACGTGCCGCAGGAGGAGCTGGGCGGCGAGTCGCCCAAGTGGCAGGTGGCCGTCATGGTCGGCCTCGTCTGTCTC
CTCCACGGCCTGGCCGTCGTCATCGTCACCGGCGTCTTCGCCATCGCCGTGCCCAGCCACCTGACGGCCTGGGCC
AACGTGCTGGGCGTCATGGCCGCCGTCCTGGCCGCGATCCAGTACGTGCCCCAGATCTGGATGACGTACCACCTC
AAGCACGTCGGCAGCCTGAGCATCCCGATGATGTGCATCCAGACGCCGGGCGGCTTCCTCTTCGCCGCCAGCCTG
TTCGCGAGGCTGGGGCCGGCCGGGTGGAGCACCTGGGTCATCTACCTGATGACGGCCGTCATGCAGGGCACCGTG
CTGGCCCTCGGGGTCTACTACGAGATCGCGGCGCGGCGGCACGAGGGCCACGGCGTCGAATACCCGGCCAGCGTG
CCGCACTCGCCGCTGGAGCGGTCGGGCTTCCCGCGGCGGCCGTCGGCGAGCCGGACCTACTCGGAAGGCTGGGAA
CGCGGGCTGCCGGGGCCCTTTACCGGCCACCCGGAGCGCTACGCCGAGACGGAGGAGGACCTGGACCACATGCAG
GAGCGCGAGGAGCGGGCGATTGCGAGGGAGAACCAGCCGCTGCTCCGGCCGGGCGGCATAGGCAACCCGCGCCGG
AATTACGATTCGAGCCGCAGCTAA
Transcript >Hirsu2|10715
ATGGACTTCGAGGCGCTGGCCCAGGCCGAGTGCGAGCGGCTCAAGTCGCCCTCGTACCTCGAGCTCATCGTCTCC
GTACTGATCCTCGTCGGACTGCTGATATCGTACCTGCCGCAACACTACCGCATCATCTCCAGGGGCACCTCGGAG
GGCATCTCGCCCTACTTCGTCCTCCTCGGAACGACGTCGGCCACGGCCGGCTTCGCCAACATCCTCACCGTCCCG
CCGTCGCGCGCCGCCATCGGCTGCTGCAAGGAGCTGGGCACCTTTGAGTGCGCCGCCGGATTGCTGGGCGTCGCC
CAGCTCGGCGTGCAGTGGCTGTGCTTCACCCTCATCCTCGTCCTCTTCCTCATCTTCTTCCGCTACCGCGAGGCC
AACGTGCCGCAGGAGGAGCTGGGCGGCGAGTCGCCCAAGTGGCAGGTGGCCGTCATGGTCGGCCTCGTCTGTCTC
CTCCACGGCCTGGCCGTCGTCATCGTCACCGGCGTCTTCGCCATCGCCGTGCCCAGCCACCTGACGGCCTGGGCC
AACGTGCTGGGCGTCATGGCCGCCGTCCTGGCCGCGATCCAGTACGTGCCCCAGATCTGGATGACGTACCACCTC
AAGCACGTCGGCAGCCTGAGCATCCCGATGATGTGCATCCAGACGCCGGGCGGCTTCCTCTTCGCCGCCAGCCTG
TTCGCGAGGCTGGGGCCGGCCGGGTGGAGCACCTGGGTCATCTACCTGATGACGGCCGTCATGCAGGGCACCGTG
CTGGCCCTCGGGGTCTACTACGAGATCGCGGCGCGGCGGCACGAGGGCCACGGCGTCGAATACCCGGCCAGCGTG
CCGCACTCGCCGCTGGAGCGGTCGGGCTTCCCGCGGCGGCCGTCGGCGAGCCGGACCTACTCGGAAGGCTGGGAA
CGCGGGCTGCCGGGGCCCTTTACCGGCCACCCGGAGCGCTACGCCGAGACGGAGGAGGACCTGGACCACATGCAG
GAGCGCGAGGAGCGGGCGATTGCGAGGGAGAACCAGCCGCTGCTCCGGCCGGGCGGCATAGGCAACCCGCGCCGG
AATTACGATTCGAGCCGCAGCTAA
Gene >Hirsu2|10715
ATGGACTTCGAGGCGCTGGCCCAGGCCGAGTGCGAGCGGCTCAAGTCGCCCTCGTACCTCGAGCTCATCGTCTCC
GTGTGCGCCCATTCCTGCCTTCCATCTCCGTTGACGCGCTTCGCTGACGACAGGCTAGACTGATCCTCGTCGGAC
TGCTGATATCGTACCTGCCGCAACACTACCGCATCATCTCCAGGGGCACCTCGGAGGGCATCTCGCCCTACTTCG
TCCTCCTCGGAACGACGTCGGCCACGGCCGGCTTCGCCAACATCCTCACCGTCCCGCCGTCGCGCGCCGCCATCG
GCTGCTGCAAGGAGCTGGGCACCTTTGAGTGCGCCGCCGGATTGCTGGGCGTCGCCCAGCTCGGCGTGCAGTGGC
TGTGCTTCACCCTCATGTAGGTGCCGGACGCGACGAGCCGACGCCCGCGACGCCGCTGACCCGCCCCGCCCGCAG
CCTCGTCCTCTTCCTCATCTTCTTCCGCTACCGCGAGGCCAACGTGCCGCAGGAGGAGCTGGGCGGCGAGTCGCC
CAAGTGGCAGGTGGCCGTCATGGTCGGCCTCGTCTGTCTCCTCCACGGCCTGGCCGTCGTCATCGTCACCGGCGT
CTTCGCCATCGCCGTGCCCAGCCACCTGACGGCCTGGGCCAACGTGCTGGGCGTCATGGCCGCCGTCCTGGCCGC
GATCCAGTACGTGCCCCAGATCTGGATGACGTACCACCTCAAGCACGTCGGCAGCCTGAGCATCCCGATGATGTG
CATCCAGACGCCGGGCGGCTTCCTCTTCGCCGCCAGCCTGTTCGCGAGGCTGGGGCCGGCCGGGTGGAGCACCTG
GGTCATCTACCTGATGACGGCCGTCATGCAGGGCACCGTGCTGGCCCTCGGGGTCTACTACGAGATCGCGGCGCG
GCGGCACGAGGGCCACGGCGTCGAATACCCGGCCAGCGTGCCGCACTCGCCGCTGGAGCGGTCGGGCTTCCCGCG
GCGGCCGTCGGCGAGCCGGACCTACTCGGAAGGCTGGGAACGCGGGCTGCCGGGGCCCTTTACCGGCCACCCGGA
GCGCTACGCCGAGACGGAGGAGGACCTGGACCACATGCAGGAGCGCGAGGAGCGGGCGATTGCGAGGGAGAACCA
GCCGCTGCTCCGGCCGGGCGGCATAGGCAACCCGCGCCGGAATTACGATTCGAGCCGCAGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail