Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10715
Gene name
LocationContig_895:7236..8425
Strand+
Gene length (bp)1189
Transcript length (bp)1074
Coding sequence length (bp)1074
Protein length (aa) 358

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 1.5E-09 23 73
PF04193 PQ-loop PQ loop repeat 2.2E-13 175 228

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14166|YDX3_SCHPO Uncharacterized protein C4C5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4C5.03 PE=4 SV=1 21 265 2.0E-32

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 20 38 18
2 51 73 22
3 97 119 22
4 145 167 22
5 172 191 19
6 203 225 22
7 235 257 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10715
MDFEALAQAECERLKSPSYLELIVSVLILVGLLISYLPQHYRIISRGTSEGISPYFVLLGTTSATAGFANILTVP
PSRAAIGCCKELGTFECAAGLLGVAQLGVQWLCFTLILVLFLIFFRYREANVPQEELGGESPKWQVAVMVGLVCL
LHGLAVVIVTGVFAIAVPSHLTAWANVLGVMAAVLAAIQYVPQIWMTYHLKHVGSLSIPMMCIQTPGGFLFAASL
FARLGPAGWSTWVIYLMTAVMQGTVLALGVYYEIAARRHEGHGVEYPASVPHSPLERSGFPRRPSASRTYSEGWE
RGLPGPFTGHPERYAETEEDLDHMQEREERAIARENQPLLRPGGIGNPRRNYDSSRS*
Coding >Hirsu2|10715
ATGGACTTCGAGGCGCTGGCCCAGGCCGAGTGCGAGCGGCTCAAGTCGCCCTCGTACCTCGAGCTCATCGTCTCC
GTACTGATCCTCGTCGGACTGCTGATATCGTACCTGCCGCAACACTACCGCATCATCTCCAGGGGCACCTCGGAG
GGCATCTCGCCCTACTTCGTCCTCCTCGGAACGACGTCGGCCACGGCCGGCTTCGCCAACATCCTCACCGTCCCG
CCGTCGCGCGCCGCCATCGGCTGCTGCAAGGAGCTGGGCACCTTTGAGTGCGCCGCCGGATTGCTGGGCGTCGCC
CAGCTCGGCGTGCAGTGGCTGTGCTTCACCCTCATCCTCGTCCTCTTCCTCATCTTCTTCCGCTACCGCGAGGCC
AACGTGCCGCAGGAGGAGCTGGGCGGCGAGTCGCCCAAGTGGCAGGTGGCCGTCATGGTCGGCCTCGTCTGTCTC
CTCCACGGCCTGGCCGTCGTCATCGTCACCGGCGTCTTCGCCATCGCCGTGCCCAGCCACCTGACGGCCTGGGCC
AACGTGCTGGGCGTCATGGCCGCCGTCCTGGCCGCGATCCAGTACGTGCCCCAGATCTGGATGACGTACCACCTC
AAGCACGTCGGCAGCCTGAGCATCCCGATGATGTGCATCCAGACGCCGGGCGGCTTCCTCTTCGCCGCCAGCCTG
TTCGCGAGGCTGGGGCCGGCCGGGTGGAGCACCTGGGTCATCTACCTGATGACGGCCGTCATGCAGGGCACCGTG
CTGGCCCTCGGGGTCTACTACGAGATCGCGGCGCGGCGGCACGAGGGCCACGGCGTCGAATACCCGGCCAGCGTG
CCGCACTCGCCGCTGGAGCGGTCGGGCTTCCCGCGGCGGCCGTCGGCGAGCCGGACCTACTCGGAAGGCTGGGAA
CGCGGGCTGCCGGGGCCCTTTACCGGCCACCCGGAGCGCTACGCCGAGACGGAGGAGGACCTGGACCACATGCAG
GAGCGCGAGGAGCGGGCGATTGCGAGGGAGAACCAGCCGCTGCTCCGGCCGGGCGGCATAGGCAACCCGCGCCGG
AATTACGATTCGAGCCGCAGCTAA
Transcript >Hirsu2|10715
ATGGACTTCGAGGCGCTGGCCCAGGCCGAGTGCGAGCGGCTCAAGTCGCCCTCGTACCTCGAGCTCATCGTCTCC
GTACTGATCCTCGTCGGACTGCTGATATCGTACCTGCCGCAACACTACCGCATCATCTCCAGGGGCACCTCGGAG
GGCATCTCGCCCTACTTCGTCCTCCTCGGAACGACGTCGGCCACGGCCGGCTTCGCCAACATCCTCACCGTCCCG
CCGTCGCGCGCCGCCATCGGCTGCTGCAAGGAGCTGGGCACCTTTGAGTGCGCCGCCGGATTGCTGGGCGTCGCC
CAGCTCGGCGTGCAGTGGCTGTGCTTCACCCTCATCCTCGTCCTCTTCCTCATCTTCTTCCGCTACCGCGAGGCC
AACGTGCCGCAGGAGGAGCTGGGCGGCGAGTCGCCCAAGTGGCAGGTGGCCGTCATGGTCGGCCTCGTCTGTCTC
CTCCACGGCCTGGCCGTCGTCATCGTCACCGGCGTCTTCGCCATCGCCGTGCCCAGCCACCTGACGGCCTGGGCC
AACGTGCTGGGCGTCATGGCCGCCGTCCTGGCCGCGATCCAGTACGTGCCCCAGATCTGGATGACGTACCACCTC
AAGCACGTCGGCAGCCTGAGCATCCCGATGATGTGCATCCAGACGCCGGGCGGCTTCCTCTTCGCCGCCAGCCTG
TTCGCGAGGCTGGGGCCGGCCGGGTGGAGCACCTGGGTCATCTACCTGATGACGGCCGTCATGCAGGGCACCGTG
CTGGCCCTCGGGGTCTACTACGAGATCGCGGCGCGGCGGCACGAGGGCCACGGCGTCGAATACCCGGCCAGCGTG
CCGCACTCGCCGCTGGAGCGGTCGGGCTTCCCGCGGCGGCCGTCGGCGAGCCGGACCTACTCGGAAGGCTGGGAA
CGCGGGCTGCCGGGGCCCTTTACCGGCCACCCGGAGCGCTACGCCGAGACGGAGGAGGACCTGGACCACATGCAG
GAGCGCGAGGAGCGGGCGATTGCGAGGGAGAACCAGCCGCTGCTCCGGCCGGGCGGCATAGGCAACCCGCGCCGG
AATTACGATTCGAGCCGCAGCTAA
Gene >Hirsu2|10715
ATGGACTTCGAGGCGCTGGCCCAGGCCGAGTGCGAGCGGCTCAAGTCGCCCTCGTACCTCGAGCTCATCGTCTCC
GTGTGCGCCCATTCCTGCCTTCCATCTCCGTTGACGCGCTTCGCTGACGACAGGCTAGACTGATCCTCGTCGGAC
TGCTGATATCGTACCTGCCGCAACACTACCGCATCATCTCCAGGGGCACCTCGGAGGGCATCTCGCCCTACTTCG
TCCTCCTCGGAACGACGTCGGCCACGGCCGGCTTCGCCAACATCCTCACCGTCCCGCCGTCGCGCGCCGCCATCG
GCTGCTGCAAGGAGCTGGGCACCTTTGAGTGCGCCGCCGGATTGCTGGGCGTCGCCCAGCTCGGCGTGCAGTGGC
TGTGCTTCACCCTCATGTAGGTGCCGGACGCGACGAGCCGACGCCCGCGACGCCGCTGACCCGCCCCGCCCGCAG
CCTCGTCCTCTTCCTCATCTTCTTCCGCTACCGCGAGGCCAACGTGCCGCAGGAGGAGCTGGGCGGCGAGTCGCC
CAAGTGGCAGGTGGCCGTCATGGTCGGCCTCGTCTGTCTCCTCCACGGCCTGGCCGTCGTCATCGTCACCGGCGT
CTTCGCCATCGCCGTGCCCAGCCACCTGACGGCCTGGGCCAACGTGCTGGGCGTCATGGCCGCCGTCCTGGCCGC
GATCCAGTACGTGCCCCAGATCTGGATGACGTACCACCTCAAGCACGTCGGCAGCCTGAGCATCCCGATGATGTG
CATCCAGACGCCGGGCGGCTTCCTCTTCGCCGCCAGCCTGTTCGCGAGGCTGGGGCCGGCCGGGTGGAGCACCTG
GGTCATCTACCTGATGACGGCCGTCATGCAGGGCACCGTGCTGGCCCTCGGGGTCTACTACGAGATCGCGGCGCG
GCGGCACGAGGGCCACGGCGTCGAATACCCGGCCAGCGTGCCGCACTCGCCGCTGGAGCGGTCGGGCTTCCCGCG
GCGGCCGTCGGCGAGCCGGACCTACTCGGAAGGCTGGGAACGCGGGCTGCCGGGGCCCTTTACCGGCCACCCGGA
GCGCTACGCCGAGACGGAGGAGGACCTGGACCACATGCAGGAGCGCGAGGAGCGGGCGATTGCGAGGGAGAACCA
GCCGCTGCTCCGGCCGGGCGGCATAGGCAACCCGCGCCGGAATTACGATTCGAGCCGCAGCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail