Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10712
Gene name
LocationContig_895:764..2294
Strand+
Gene length (bp)1530
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04577 DUF563 Protein of unknown function (DUF563) 1.3E-32 232 457

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BYW9|EOGT_MOUSE EGF domain-specific O-linked N-acetylglucosamine transferase OS=Mus musculus GN=Eogt PE=1 SV=1 221 472 4.0E-14
sp|Q5NDL9|EOGT_CANLF EGF domain-specific O-linked N-acetylglucosamine transferase OS=Canis lupus familiaris GN=EOGT PE=2 SV=1 221 472 4.0E-14
sp|A0JND3|EOGT_BOVIN EGF domain-specific O-linked N-acetylglucosamine transferase OS=Bos taurus GN=EOGT PE=2 SV=1 221 472 5.0E-14
sp|Q5NDL2|EOGT_HUMAN EGF domain-specific O-linked N-acetylglucosamine transferase OS=Homo sapiens GN=EOGT PE=1 SV=1 331 472 8.0E-14
sp|Q5NDL1|EOGT_PANTR EGF domain-specific O-linked N-acetylglucosamine transferase OS=Pan troglodytes GN=EOGT PE=2 SV=1 331 472 9.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BYW9|EOGT_MOUSE EGF domain-specific O-linked N-acetylglucosamine transferase OS=Mus musculus GN=Eogt PE=1 SV=1 221 472 4.0E-14
sp|Q5NDL9|EOGT_CANLF EGF domain-specific O-linked N-acetylglucosamine transferase OS=Canis lupus familiaris GN=EOGT PE=2 SV=1 221 472 4.0E-14
sp|A0JND3|EOGT_BOVIN EGF domain-specific O-linked N-acetylglucosamine transferase OS=Bos taurus GN=EOGT PE=2 SV=1 221 472 5.0E-14
sp|Q5NDL2|EOGT_HUMAN EGF domain-specific O-linked N-acetylglucosamine transferase OS=Homo sapiens GN=EOGT PE=1 SV=1 331 472 8.0E-14
sp|Q5NDL1|EOGT_PANTR EGF domain-specific O-linked N-acetylglucosamine transferase OS=Pan troglodytes GN=EOGT PE=2 SV=1 331 472 9.0E-14
sp|Q5NDL0|EOGT_RAT EGF domain-specific O-linked N-acetylglucosamine transferase OS=Rattus norvegicus GN=Eogt PE=2 SV=1 221 472 7.0E-13
sp|Q5NDL3|EOGT_CHICK EGF domain-specific O-linked N-acetylglucosamine transferase OS=Gallus gallus GN=EOGT PE=2 SV=2 221 472 1.0E-12
sp|Q9VQB7|EOGT_DROME EGF domain-specific O-linked N-acetylglucosamine transferase OS=Drosophila melanogaster GN=Eogt PE=1 SV=1 215 459 7.0E-12
sp|Q6GQ23|EOGT_XENLA EGF domain-specific O-linked N-acetylglucosamine transferase OS=Xenopus laevis GN=eogt PE=2 SV=1 331 472 9.0E-12
sp|Q08CY9|EOGT_XENTR EGF domain-specific O-linked N-acetylglucosamine transferase OS=Xenopus tropicalis GN=eogt PE=2 SV=1 331 472 1.0E-10
sp|Q9LDH0|XYLT_ARATH Beta-(1,2)-xylosyltransferase OS=Arabidopsis thaliana GN=XYLT PE=1 SV=1 372 463 7.0E-07
sp|Q5NDE3|PMGT2_TETNG Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 OS=Tetraodon nigroviridis GN=pomgnt2 PE=2 SV=1 270 457 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016757 transferase activity, transferring glycosyl groups Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10712
MLLLAASRRLRLSAIASAVFVALLLLLLYGHAQQRGHGLRGPRRPPNSSPPPHQPPDQQQQQQQQPALPPEYAVP
STESAWCQDRFDTRYLFNARNSSASYCSPDSASRLTCFWSATAKGRQDAMCFAQRARFHAASHSFRLACRLRPLT
ADETAAGLPSVPDRLPRYWYETGPAVVMDQAVVLGDDDSDSNNNDNSNNNNDMAAVEQAAPTTTTTTKTTTILVK
REGNANLWHSLMEIMSLSWSLDLLHIALDPDSGQPFLTPRAGHRAQVVLLDEHDDGNYIALWQLFARMPVRRLRD
LDASEPPSDLVVPLAGGSNPLWQGDWDDLLCRDSALVKTFVSRALAHYRVTDVDADDADVVVTYISRAHTRRLVD
EAEHMDALRRAIPHMQLNVVDFAALPFVDQLRLVRRTDLLVGVHGAGLTHLMFLRPGSTVLEILPDGFQHKGFRN
LAQMLGLGFLRTHAKMRPDESGARDWQVNPVEMDRQRLIDVVAVAVKSLYNAGLRSHDV*
Coding >Hirsu2|10712
ATGCTGCTCCTCGCCGCCTCTCGCCGCCTTCGCCTGTCGGCCATCGCCTCGGCCGTCTTCGTCGCCCTGCTGCTC
CTCCTGCTGTACGGCCATGCCCAGCAGCGCGGCCACGGCCTGCGAGGCCCGCGCCGCCCGCCCAACAGCAGCCCT
CCTCCCCATCAGCCTCCTGACCAGCAGCAGCAGCAGCAGCAGCAGCCCGCCCTGCCGCCCGAGTACGCCGTCCCG
TCGACCGAGAGCGCCTGGTGCCAGGACCGCTTCGACACGCGCTACCTCTTCAACGCCCGCAACTCGTCGGCCTCG
TACTGCAGCCCGGACTCGGCCTCGCGCCTGACGTGCTTCTGGTCCGCCACGGCCAAGGGCCGCCAAGACGCCATG
TGCTTCGCCCAGCGCGCCCGCTTCCACGCCGCCTCCCACTCCTTCCGCCTGGCCTGCCGCCTGAGGCCGCTGACG
GCCGACGAGACGGCCGCCGGCCTGCCCTCGGTGCCCGACCGCCTGCCCCGCTACTGGTACGAGACGGGGCCGGCC
GTCGTCATGGACCAGGCCGTCGTCCTCGGCGACGACGACAGTGACAGCAACAACAACGACAACAGCAACAACAAC
AACGACATGGCCGCCGTGGAGCAGGCGGCACCCACGACGACGACGACGACGAAAACGACAACGATACTCGTCAAG
CGCGAGGGCAACGCCAACCTCTGGCACTCCCTCATGGAAATCATGAGCCTCTCCTGGTCCCTCGACCTCCTCCAC
ATCGCCCTCGACCCCGACTCCGGCCAGCCCTTCCTCACGCCCCGCGCCGGCCACCGCGCCCAGGTCGTGCTGCTC
GACGAGCACGACGACGGCAACTACATCGCCCTGTGGCAGCTCTTCGCCCGCATGCCCGTCCGCCGACTCCGCGAC
CTCGACGCCTCGGAGCCGCCCTCCGACCTCGTCGTCCCCCTGGCCGGCGGCAGCAACCCGCTGTGGCAGGGCGAC
TGGGATGACCTGCTCTGCCGCGATTCGGCCCTCGTCAAGACGTTCGTCTCGCGCGCCCTCGCCCACTACCGCGTC
ACCGACGTCGACGCCGACGACGCCGACGTCGTCGTCACCTACATCAGCCGCGCCCACACCCGCCGTCTCGTCGAC
GAGGCCGAGCACATGGACGCCCTGCGCCGCGCCATCCCCCACATGCAGCTCAACGTCGTCGACTTCGCCGCCCTG
CCCTTTGTCGACCAGCTCCGGCTGGTCCGCCGCACCGACCTGCTCGTCGGCGTCCACGGCGCCGGCCTCACCCAC
CTCATGTTCCTGCGGCCCGGCTCGACCGTGCTCGAGATCCTGCCCGACGGCTTCCAGCACAAGGGCTTCCGCAAC
CTGGCCCAGATGCTCGGCCTCGGCTTCCTCCGCACCCACGCCAAGATGCGCCCGGACGAGTCGGGCGCCCGGGAC
TGGCAGGTCAACCCCGTCGAGATGGACCGCCAGCGCCTGATTGACGTCGTCGCCGTCGCCGTGAAGAGCCTGTAC
AACGCCGGCCTGCGAAGCCACGACGTCTGA
Transcript >Hirsu2|10712
ATGCTGCTCCTCGCCGCCTCTCGCCGCCTTCGCCTGTCGGCCATCGCCTCGGCCGTCTTCGTCGCCCTGCTGCTC
CTCCTGCTGTACGGCCATGCCCAGCAGCGCGGCCACGGCCTGCGAGGCCCGCGCCGCCCGCCCAACAGCAGCCCT
CCTCCCCATCAGCCTCCTGACCAGCAGCAGCAGCAGCAGCAGCAGCCCGCCCTGCCGCCCGAGTACGCCGTCCCG
TCGACCGAGAGCGCCTGGTGCCAGGACCGCTTCGACACGCGCTACCTCTTCAACGCCCGCAACTCGTCGGCCTCG
TACTGCAGCCCGGACTCGGCCTCGCGCCTGACGTGCTTCTGGTCCGCCACGGCCAAGGGCCGCCAAGACGCCATG
TGCTTCGCCCAGCGCGCCCGCTTCCACGCCGCCTCCCACTCCTTCCGCCTGGCCTGCCGCCTGAGGCCGCTGACG
GCCGACGAGACGGCCGCCGGCCTGCCCTCGGTGCCCGACCGCCTGCCCCGCTACTGGTACGAGACGGGGCCGGCC
GTCGTCATGGACCAGGCCGTCGTCCTCGGCGACGACGACAGTGACAGCAACAACAACGACAACAGCAACAACAAC
AACGACATGGCCGCCGTGGAGCAGGCGGCACCCACGACGACGACGACGACGAAAACGACAACGATACTCGTCAAG
CGCGAGGGCAACGCCAACCTCTGGCACTCCCTCATGGAAATCATGAGCCTCTCCTGGTCCCTCGACCTCCTCCAC
ATCGCCCTCGACCCCGACTCCGGCCAGCCCTTCCTCACGCCCCGCGCCGGCCACCGCGCCCAGGTCGTGCTGCTC
GACGAGCACGACGACGGCAACTACATCGCCCTGTGGCAGCTCTTCGCCCGCATGCCCGTCCGCCGACTCCGCGAC
CTCGACGCCTCGGAGCCGCCCTCCGACCTCGTCGTCCCCCTGGCCGGCGGCAGCAACCCGCTGTGGCAGGGCGAC
TGGGATGACCTGCTCTGCCGCGATTCGGCCCTCGTCAAGACGTTCGTCTCGCGCGCCCTCGCCCACTACCGCGTC
ACCGACGTCGACGCCGACGACGCCGACGTCGTCGTCACCTACATCAGCCGCGCCCACACCCGCCGTCTCGTCGAC
GAGGCCGAGCACATGGACGCCCTGCGCCGCGCCATCCCCCACATGCAGCTCAACGTCGTCGACTTCGCCGCCCTG
CCCTTTGTCGACCAGCTCCGGCTGGTCCGCCGCACCGACCTGCTCGTCGGCGTCCACGGCGCCGGCCTCACCCAC
CTCATGTTCCTGCGGCCCGGCTCGACCGTGCTCGAGATCCTGCCCGACGGCTTCCAGCACAAGGGCTTCCGCAAC
CTGGCCCAGATGCTCGGCCTCGGCTTCCTCCGCACCCACGCCAAGATGCGCCCGGACGAGTCGGGCGCCCGGGAC
TGGCAGGTCAACCCCGTCGAGATGGACCGCCAGCGCCTGATTGACGTCGTCGCCGTCGCCGTGAAGAGCCTGTAC
AACGCCGGCCTGCGAAGCCACGACGTCTGA
Gene >Hirsu2|10712
ATGCTGCTCCTCGCCGCCTCTCGCCGCCTTCGCCTGTCGGCCATCGCCTCGGCCGTCTTCGTCGCCCTGCTGCTC
CTCCTGCTGTACGGCCATGCCCAGCAGCGCGGCCACGGCCTGCGAGGCCCGCGCCGCCCGCCCAACAGCAGCCCT
CCTCCCCATCAGCCTCCTGACCAGCAGCAGCAGCAGCAGCAGCAGCCCGCCCTGCCGCCCGAGTACGCCGTCCCG
TCGACCGAGAGCGCCTGGTGCCAGGACCGCTTCGACACGCGCTACCTCTTCAACGCCCGCAACTCGTCGGCCTCG
TACTGCAGCCCGGACTCGGCCTCGCGCCTGACGTGCTTCTGGTCCGCCACGGCCAAGGGCCGCCAAGACGCCATG
TGCTTCGCCCAGCGCGCCCGCTTCCACGCCGCCTCCCACTCCTTCCGCCTGGCCTGCCGCCTGAGGCCGCTGACG
GCCGACGAGACGGCCGCCGGCCTGCCCTCGGTGCCCGACCGCCTGCCCCGCTACTGGTACGAGACGGGGCCGGCC
GTCGTCATGGACCAGGCCGTCGTCCTCGGCGACGACGACAGTGACAGCAACAACAACGACAACAGCAACAACAAC
AACGACATGGCCGCCGTGGAGCAGGCGGCACCCACGACGACGACGACGACGAAAACGACAACGATACTCGTCAAG
CGCGAGGGCAACGCCAACCTCTGGCACTCCCTCATGGAAATCATGAGCCTCTCCTGGTCCCTCGACCTCCTCCAC
ATCGCCCTCGACCCCGACTCCGGCCAGCCCTTCCTCACGCCCCGCGCCGGCCACCGCGCCCAGGTCGTGCTGCTC
GACGAGCACGACGACGGCAACTACATCGCCCTGTGGCAGCTCTTCGCCCGCATGCCCGTCCGCCGACTCCGCGAC
CTCGACGCCTCGGAGCCGCCCTCCGACCTCGTCGTCCCCCTGGCCGGCGGCAGCAACCCGCTGTGGCAGGGCGAC
TGGGATGACCTGCTCTGCCGCGATTCGGCCCTCGTCAAGACGTTCGTCTCGCGCGCCCTCGCCCACTACCGCGTC
ACCGACGTCGACGCCGACGACGCCGACGTCGTCGTCACCTACATCAGCCGCGCCCACACCCGCCGTCTCGTCGAC
GAGGCCGAGCACATGGACGCCCTGCGCCGCGCCATCCCCCACATGCAGCTCAACGTCGTCGACTTCGCCGCCCTG
CCCTTTGTCGACCAGCTCCGGCTGGTCCGCCGCACCGACCTGCTCGTCGGCGTCCACGGCGCCGGCCTCACCCAC
CTCATGTTCCTGCGGCCCGGCTCGACCGTGCTCGAGATCCTGCCCGACGGCTTCCAGCACAAGGGCTTCCGCAAC
CTGGCCCAGATGCTCGGCCTCGGCTTCCTCCGCACCCACGCCAAGATGCGCCCGGACGAGTCGGGCGCCCGGGAC
TGGCAGGTCAACCCCGTCGAGATGGACCGCCAGCGCCTGATTGACGTCGTCGCCGTCGCCGTGAAGAGCCTGTAC
AACGCCGGCCTGCGAAGCCACGACGTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail