Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1071
Gene name
LocationContig_1220:2..4393
Strand-
Gene length (bp)4391
Transcript length (bp)4179
Coding sequence length (bp)4179
Protein length (aa) 1393

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03177 Nucleoporin_C Non-repetitive/WGA-negative nucleoporin C-terminal 7.8E-164 643 1272
PF08801 Nucleoporin_N Nup133 N terminal like 2.9E-82 111 568

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G0S9A7|NU133_CHATD Nucleoporin NUP133 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP133 PE=3 SV=1 1 1373 0.0E+00
sp|Q9UTH0|NU132_SCHPO Nucleoporin nup132 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup132 PE=1 SV=1 587 1299 2.0E-24
sp|Q9P797|NU131_SCHPO Nucleoporin nup131 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup131 PE=1 SV=3 158 569 4.0E-17
sp|P36161|NU133_YEAST Nucleoporin NUP133 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP133 PE=1 SV=1 60 661 6.0E-17
sp|Q9UTH0|NU132_SCHPO Nucleoporin nup132 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup132 PE=1 SV=1 132 295 5.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1071
MFSPSTAQGGPATATRSRRRQRPKSSESLVQQPKAKRQRVPLTEQTFINPEPQPETVDLKAEKVPAADAKNDVSM
DDVHHASRKELPVRAKKSKHSDRAANKGDGSLVLASTNAFTVSKLPALPDRIRSDWSGNQHAEIFSPSGFALTLT
STHAIVWPYNATSQSPETFTFTLPSASKPSDPLPVGCLVSPSASSTEPGLVVVMSGSGKVVYWESISSAATFAFI
KKDRSGVEHMISGMSSGEKVISITNAESAGFILTFSTGRLAYMSVRDGHGRPAISIQFLRAGPATSGTSLFGSIR
HAFSHLSPRGDIAAVRADRSARVGERSIVSLSSKGKLQSWMVHRGGHHEPVGEAEVRERLVAALQDTDRASQEFP
AESFEALDFVYVPKGLEHKYLKLSRLSDAMASDSPSVQHLLLLVSLTSKGVSRYMLVETILTPSDCQIGMIRPIT
SYSTPWTQADSAQSTRPRIYLPRPALVAFVVFDHAAIVASVAIPPESPESQLQTDSHILPASFEDVVDFREDNVH
EIVGSGFEETPAVSGGHDENRAARHKTKNPAVVLVVRGAGVVRILTTDVDKFASDQPPRVSAKSKLEQAVFFGTK
KDNPLVFDGRQDFNFTNEEIADAALEVSHEILSSTTSYLSTLPASMEENLRARSNALERLMLHLRAIGVDLDRKT
RWKLLYNAEKMHVATILWRRHEAFTARRPADDKKSLVGSIVEFIHEVHDCHPNRNIGELDAVRHWFSNDIYRLEI
FVSWAYEVIKVLYKDELLDETRMTVMLHEAMHINISAHSGAHDFRRSNLSFYGLGQEQLRMGILRDGYEDLPEPW
TGNPFLANNSKRLTDLCEQWLQSYEKSRKTKLVSKPPASSGVAMIYDDMPALVDGMLTAVLEYARWGTANCDRHE
LANSDRKGLPKDYAKTYDTERHDKPVSLARFGKWEQGAKIAEKHGCLSGLAVILLEHIEMLESQLSEPGLSAAET
TSLRAARQAKKTQMEDSFGKYGEPFAFPVYETLLEKHGVAAVLEFELDTLGFKTRFLRSRPGLARISWINDIQQE
KDVDHAADTLMSLALTAEDQVWKKKIELSLGKLALLAEAETEPQPQQHSFTVKSDAAVREKKLERVEKELIMVRI
QDCLYNQILPSTYDAVDSAAALNFALELHSTNVPRRQKALLQLFTDGMAKLLDHQALDAMSLIDLLTLVALGPES
REEIVHPFWMALKVADSACHSDEVRDAKKLIWRRLFIRDDWAKLNDTQLKDDVEVVSRIAETELCAMFTDCIRYQ
DPKEPFRYVEPQEVLGVFTETLDRRFQNFADNEQAKLVEAMRWEDKVLAQYMEKNRLSKWVQTAYETAQTEVESL
AEEAARRGSSSSDSREPLSLTGRRRSSAAGHGASLFGPAAAQ*
Coding >Hirsu2|1071
ATGTTTTCTCCCTCGACCGCTCAGGGGGGCCCCGCGACGGCAACCCGATCGCGCCGTCGCCAGCGACCCAAGAGC
TCGGAAAGCCTGGTCCAGCAGCCCAAGGCCAAACGACAGCGCGTCCCGCTGACGGAGCAGACCTTCATCAACCCC
GAGCCCCAACCGGAGACGGTCGACCTCAAGGCAGAAAAGGTGCCGGCGGCCGATGCGAAGAACGACGTGTCCATG
GATGATGTCCATCATGCCTCTCGCAAGGAACTGCCTGTGCGGGCCAAAAAGTCCAAGCACAGCGATCGAGCTGCG
AATAAGGGCGATGGCAGCCTCGTCTTGGCGAGCACAAATGCCTTCACTGTTTCGAAGCTGCCTGCGCTGCCGGAC
AGGATAAGGTCGGATTGGTCGGGGAATCAACACGCCGAGATCTTTTCGCCATCCGGATTCGCCCTGACTCTAACG
TCGACGCACGCCATCGTCTGGCCCTACAACGCGACGTCGCAATCGCCCGAAACATTCACATTCACTTTGCCTTCC
GCTTCGAAACCCAGCGACCCTCTGCCCGTAGGATGCCTTGTCTCCCCGTCAGCCTCGTCGACCGAACCCGGGCTG
GTCGTTGTCATGTCCGGCAGCGGCAAAGTTGTGTACTGGGAGTCCATCTCCAGCGCCGCCACCTTCGCCTTCATC
AAAAAGGATCGATCCGGCGTCGAACACATGATATCCGGCATGTCTTCGGGAGAAAAGGTCATTTCCATCACCAAC
GCCGAGTCCGCAGGCTTCATCTTGACCTTCAGCACCGGACGCCTGGCATACATGAGTGTCAGGGATGGCCACGGA
CGCCCCGCGATTTCGATCCAGTTCCTGCGCGCCGGCCCGGCGACCTCGGGCACCAGCCTGTTCGGCAGCATTCGC
CACGCCTTCTCGCACCTCTCCCCCCGCGGAGACATCGCCGCCGTCCGCGCCGATCGCTCGGCCCGTGTCGGCGAA
CGCAGCATCGTCTCGCTCAGCAGCAAGGGCAAACTGCAGTCCTGGATGGTTCACCGCGGCGGCCATCACGAGCCT
GTCGGCGAGGCCGAAGTGCGAGAGCGTCTGGTTGCGGCTCTTCAGGATACCGACCGCGCGAGCCAGGAGTTCCCG
GCCGAGTCCTTCGAAGCCCTGGACTTCGTCTACGTCCCCAAAGGTCTGGAGCACAAGTACCTGAAGCTGAGCAGG
CTGAGCGACGCCATGGCTTCCGACAGCCCCAGCGTGCAGCACTTGCTGCTGCTCGTCAGCCTGACCTCCAAGGGA
GTGTCACGATACATGCTGGTCGAAACCATATTGACGCCCAGCGACTGCCAGATCGGCATGATACGACCGATCACC
TCCTACTCGACCCCTTGGACCCAGGCCGACTCGGCACAGAGCACGAGGCCCCGCATCTACCTGCCGCGCCCGGCC
CTCGTGGCGTTCGTCGTCTTCGACCACGCTGCCATCGTCGCATCGGTCGCCATTCCTCCCGAGTCCCCCGAGTCC
CAGCTCCAGACCGACAGCCATATCTTGCCGGCTTCGTTCGAGGATGTTGTCGATTTTAGGGAAGACAACGTGCAC
GAAATTGTCGGCTCCGGCTTCGAAGAGACTCCTGCAGTCTCTGGCGGACACGATGAGAACCGAGCGGCCCGGCAC
AAGACGAAGAACCCGGCCGTCGTCCTCGTCGTGCGAGGCGCGGGAGTCGTGCGAATCCTGACAACGGACGTGGAC
AAGTTCGCCAGCGACCAGCCTCCCCGGGTTTCGGCTAAGAGCAAGCTGGAGCAGGCCGTCTTCTTCGGCACCAAG
AAGGACAATCCTCTGGTATTCGACGGGCGGCAGGACTTCAACTTTACGAACGAGGAGATCGCCGACGCGGCGCTC
GAGGTCAGCCACGAGATCCTCAGCTCGACGACGTCGTACCTGTCCACGTTGCCGGCGTCCATGGAGGAGAACTTG
CGTGCTCGGTCCAACGCGCTCGAGAGACTGATGCTACACCTCCGAGCCATCGGCGTCGATCTGGATCGCAAGACG
CGCTGGAAGCTCCTCTACAACGCGGAGAAGATGCATGTTGCCACCATACTGTGGAGGCGGCACGAGGCCTTCACC
GCGAGGCGGCCCGCGGACGACAAGAAGAGCTTGGTCGGCTCCATCGTCGAGTTCATCCACGAGGTCCACGATTGC
CACCCCAACAGGAACATTGGCGAGCTGGACGCGGTGAGGCACTGGTTCTCCAACGACATCTACCGCCTCGAGATT
TTCGTATCTTGGGCCTACGAAGTGATCAAGGTCCTGTACAAGGACGAGCTTCTCGATGAGACCAGGATGACCGTC
ATGCTGCACGAGGCAATGCACATTAACATCAGCGCCCATTCCGGAGCACACGACTTCCGCCGGAGCAACTTGTCC
TTTTACGGCCTCGGCCAGGAACAGCTTCGGATGGGCATCCTGCGCGACGGCTACGAAGACCTACCGGAGCCGTGG
ACCGGCAACCCCTTCCTCGCAAACAACTCCAAGCGCTTGACGGATCTGTGCGAACAATGGCTGCAGAGCTACGAG
AAGTCGCGAAAGACGAAGCTCGTGTCCAAGCCACCAGCTTCCAGCGGGGTCGCCATGATCTACGATGACATGCCC
GCCTTAGTCGACGGCATGCTGACCGCCGTGCTGGAATACGCTCGCTGGGGAACGGCGAATTGCGACCGCCACGAA
CTGGCCAATTCCGACCGCAAGGGGTTGCCCAAGGACTACGCCAAGACCTACGACACGGAACGACACGACAAGCCC
GTATCGCTGGCCCGGTTCGGCAAGTGGGAGCAGGGCGCCAAGATTGCCGAGAAGCACGGCTGCCTCAGCGGCCTG
GCCGTGATCCTGCTGGAGCACATCGAGATGCTGGAGTCTCAGCTGTCGGAGCCAGGCCTCTCGGCGGCGGAGACG
ACGAGCTTGCGGGCCGCCCGACAGGCGAAGAAGACGCAGATGGAGGACTCGTTCGGCAAATACGGCGAGCCCTTT
GCCTTCCCCGTATACGAGACACTACTCGAAAAGCACGGGGTGGCGGCTGTGTTGGAGTTCGAGCTGGACACGCTC
GGCTTCAAGACTCGATTTCTCCGGAGCAGGCCGGGCCTGGCCCGCATATCTTGGATCAACGACATCCAGCAGGAG
AAGGACGTCGACCACGCGGCCGACACACTGATGAGCCTCGCACTCACGGCAGAGGACCAGGTGTGGAAGAAGAAG
ATTGAGCTGAGTCTGGGCAAGCTCGCTCTTCTGGCCGAGGCCGAGACGGAGCCGCAGCCGCAGCAGCATTCCTTC
ACGGTCAAGTCGGACGCGGCTGTTCGCGAGAAGAAGCTGGAGCGGGTCGAGAAGGAGCTGATCATGGTCAGGATC
CAGGACTGCCTGTACAACCAGATCCTGCCCAGCACGTACGACGCCGTCGACAGCGCGGCCGCCCTCAACTTCGCC
CTCGAGCTCCACAGCACCAACGTCCCCCGGCGGCAAAAGGCACTTCTGCAACTCTTCACCGACGGCATGGCGAAG
CTGCTGGACCACCAGGCCCTCGATGCCATGAGCCTCATCGACCTGCTGACCCTGGTGGCGCTCGGCCCGGAGTCG
AGGGAGGAGATTGTGCACCCGTTCTGGATGGCGCTGAAGGTGGCAGACAGCGCCTGCCACTCGGACGAGGTCCGG
GACGCCAAGAAGCTGATCTGGCGACGGCTGTTCATCCGCGACGACTGGGCCAAGCTCAACGACACGCAGCTCAAG
GACGACGTCGAGGTCGTGAGCCGGATCGCGGAGACGGAGCTGTGCGCCATGTTCACCGACTGCATCCGATACCAG
GACCCCAAGGAGCCGTTCCGATACGTCGAGCCTCAGGAGGTGCTCGGCGTCTTCACCGAGACGCTCGACCGGCGC
TTCCAGAACTTTGCCGACAACGAGCAGGCCAAGCTGGTGGAGGCGATGCGGTGGGAGGACAAGGTGCTGGCGCAG
TACATGGAGAAGAACCGGCTCAGCAAGTGGGTGCAGACGGCGTACGAGACGGCGCAGACCGAGGTGGAGAGCCTG
GCGGAGGAGGCGGCCCGCCGCGGCAGCTCGTCGAGCGACTCGCGCGAGCCCTTGTCCCTGACGGGCCGGCGGCGC
AGCTCCGCGGCCGGCCACGGCGCGTCCCTGTTCGGCCCGGCGGCGGCGCAGTGA
Transcript >Hirsu2|1071
ATGTTTTCTCCCTCGACCGCTCAGGGGGGCCCCGCGACGGCAACCCGATCGCGCCGTCGCCAGCGACCCAAGAGC
TCGGAAAGCCTGGTCCAGCAGCCCAAGGCCAAACGACAGCGCGTCCCGCTGACGGAGCAGACCTTCATCAACCCC
GAGCCCCAACCGGAGACGGTCGACCTCAAGGCAGAAAAGGTGCCGGCGGCCGATGCGAAGAACGACGTGTCCATG
GATGATGTCCATCATGCCTCTCGCAAGGAACTGCCTGTGCGGGCCAAAAAGTCCAAGCACAGCGATCGAGCTGCG
AATAAGGGCGATGGCAGCCTCGTCTTGGCGAGCACAAATGCCTTCACTGTTTCGAAGCTGCCTGCGCTGCCGGAC
AGGATAAGGTCGGATTGGTCGGGGAATCAACACGCCGAGATCTTTTCGCCATCCGGATTCGCCCTGACTCTAACG
TCGACGCACGCCATCGTCTGGCCCTACAACGCGACGTCGCAATCGCCCGAAACATTCACATTCACTTTGCCTTCC
GCTTCGAAACCCAGCGACCCTCTGCCCGTAGGATGCCTTGTCTCCCCGTCAGCCTCGTCGACCGAACCCGGGCTG
GTCGTTGTCATGTCCGGCAGCGGCAAAGTTGTGTACTGGGAGTCCATCTCCAGCGCCGCCACCTTCGCCTTCATC
AAAAAGGATCGATCCGGCGTCGAACACATGATATCCGGCATGTCTTCGGGAGAAAAGGTCATTTCCATCACCAAC
GCCGAGTCCGCAGGCTTCATCTTGACCTTCAGCACCGGACGCCTGGCATACATGAGTGTCAGGGATGGCCACGGA
CGCCCCGCGATTTCGATCCAGTTCCTGCGCGCCGGCCCGGCGACCTCGGGCACCAGCCTGTTCGGCAGCATTCGC
CACGCCTTCTCGCACCTCTCCCCCCGCGGAGACATCGCCGCCGTCCGCGCCGATCGCTCGGCCCGTGTCGGCGAA
CGCAGCATCGTCTCGCTCAGCAGCAAGGGCAAACTGCAGTCCTGGATGGTTCACCGCGGCGGCCATCACGAGCCT
GTCGGCGAGGCCGAAGTGCGAGAGCGTCTGGTTGCGGCTCTTCAGGATACCGACCGCGCGAGCCAGGAGTTCCCG
GCCGAGTCCTTCGAAGCCCTGGACTTCGTCTACGTCCCCAAAGGTCTGGAGCACAAGTACCTGAAGCTGAGCAGG
CTGAGCGACGCCATGGCTTCCGACAGCCCCAGCGTGCAGCACTTGCTGCTGCTCGTCAGCCTGACCTCCAAGGGA
GTGTCACGATACATGCTGGTCGAAACCATATTGACGCCCAGCGACTGCCAGATCGGCATGATACGACCGATCACC
TCCTACTCGACCCCTTGGACCCAGGCCGACTCGGCACAGAGCACGAGGCCCCGCATCTACCTGCCGCGCCCGGCC
CTCGTGGCGTTCGTCGTCTTCGACCACGCTGCCATCGTCGCATCGGTCGCCATTCCTCCCGAGTCCCCCGAGTCC
CAGCTCCAGACCGACAGCCATATCTTGCCGGCTTCGTTCGAGGATGTTGTCGATTTTAGGGAAGACAACGTGCAC
GAAATTGTCGGCTCCGGCTTCGAAGAGACTCCTGCAGTCTCTGGCGGACACGATGAGAACCGAGCGGCCCGGCAC
AAGACGAAGAACCCGGCCGTCGTCCTCGTCGTGCGAGGCGCGGGAGTCGTGCGAATCCTGACAACGGACGTGGAC
AAGTTCGCCAGCGACCAGCCTCCCCGGGTTTCGGCTAAGAGCAAGCTGGAGCAGGCCGTCTTCTTCGGCACCAAG
AAGGACAATCCTCTGGTATTCGACGGGCGGCAGGACTTCAACTTTACGAACGAGGAGATCGCCGACGCGGCGCTC
GAGGTCAGCCACGAGATCCTCAGCTCGACGACGTCGTACCTGTCCACGTTGCCGGCGTCCATGGAGGAGAACTTG
CGTGCTCGGTCCAACGCGCTCGAGAGACTGATGCTACACCTCCGAGCCATCGGCGTCGATCTGGATCGCAAGACG
CGCTGGAAGCTCCTCTACAACGCGGAGAAGATGCATGTTGCCACCATACTGTGGAGGCGGCACGAGGCCTTCACC
GCGAGGCGGCCCGCGGACGACAAGAAGAGCTTGGTCGGCTCCATCGTCGAGTTCATCCACGAGGTCCACGATTGC
CACCCCAACAGGAACATTGGCGAGCTGGACGCGGTGAGGCACTGGTTCTCCAACGACATCTACCGCCTCGAGATT
TTCGTATCTTGGGCCTACGAAGTGATCAAGGTCCTGTACAAGGACGAGCTTCTCGATGAGACCAGGATGACCGTC
ATGCTGCACGAGGCAATGCACATTAACATCAGCGCCCATTCCGGAGCACACGACTTCCGCCGGAGCAACTTGTCC
TTTTACGGCCTCGGCCAGGAACAGCTTCGGATGGGCATCCTGCGCGACGGCTACGAAGACCTACCGGAGCCGTGG
ACCGGCAACCCCTTCCTCGCAAACAACTCCAAGCGCTTGACGGATCTGTGCGAACAATGGCTGCAGAGCTACGAG
AAGTCGCGAAAGACGAAGCTCGTGTCCAAGCCACCAGCTTCCAGCGGGGTCGCCATGATCTACGATGACATGCCC
GCCTTAGTCGACGGCATGCTGACCGCCGTGCTGGAATACGCTCGCTGGGGAACGGCGAATTGCGACCGCCACGAA
CTGGCCAATTCCGACCGCAAGGGGTTGCCCAAGGACTACGCCAAGACCTACGACACGGAACGACACGACAAGCCC
GTATCGCTGGCCCGGTTCGGCAAGTGGGAGCAGGGCGCCAAGATTGCCGAGAAGCACGGCTGCCTCAGCGGCCTG
GCCGTGATCCTGCTGGAGCACATCGAGATGCTGGAGTCTCAGCTGTCGGAGCCAGGCCTCTCGGCGGCGGAGACG
ACGAGCTTGCGGGCCGCCCGACAGGCGAAGAAGACGCAGATGGAGGACTCGTTCGGCAAATACGGCGAGCCCTTT
GCCTTCCCCGTATACGAGACACTACTCGAAAAGCACGGGGTGGCGGCTGTGTTGGAGTTCGAGCTGGACACGCTC
GGCTTCAAGACTCGATTTCTCCGGAGCAGGCCGGGCCTGGCCCGCATATCTTGGATCAACGACATCCAGCAGGAG
AAGGACGTCGACCACGCGGCCGACACACTGATGAGCCTCGCACTCACGGCAGAGGACCAGGTGTGGAAGAAGAAG
ATTGAGCTGAGTCTGGGCAAGCTCGCTCTTCTGGCCGAGGCCGAGACGGAGCCGCAGCCGCAGCAGCATTCCTTC
ACGGTCAAGTCGGACGCGGCTGTTCGCGAGAAGAAGCTGGAGCGGGTCGAGAAGGAGCTGATCATGGTCAGGATC
CAGGACTGCCTGTACAACCAGATCCTGCCCAGCACGTACGACGCCGTCGACAGCGCGGCCGCCCTCAACTTCGCC
CTCGAGCTCCACAGCACCAACGTCCCCCGGCGGCAAAAGGCACTTCTGCAACTCTTCACCGACGGCATGGCGAAG
CTGCTGGACCACCAGGCCCTCGATGCCATGAGCCTCATCGACCTGCTGACCCTGGTGGCGCTCGGCCCGGAGTCG
AGGGAGGAGATTGTGCACCCGTTCTGGATGGCGCTGAAGGTGGCAGACAGCGCCTGCCACTCGGACGAGGTCCGG
GACGCCAAGAAGCTGATCTGGCGACGGCTGTTCATCCGCGACGACTGGGCCAAGCTCAACGACACGCAGCTCAAG
GACGACGTCGAGGTCGTGAGCCGGATCGCGGAGACGGAGCTGTGCGCCATGTTCACCGACTGCATCCGATACCAG
GACCCCAAGGAGCCGTTCCGATACGTCGAGCCTCAGGAGGTGCTCGGCGTCTTCACCGAGACGCTCGACCGGCGC
TTCCAGAACTTTGCCGACAACGAGCAGGCCAAGCTGGTGGAGGCGATGCGGTGGGAGGACAAGGTGCTGGCGCAG
TACATGGAGAAGAACCGGCTCAGCAAGTGGGTGCAGACGGCGTACGAGACGGCGCAGACCGAGGTGGAGAGCCTG
GCGGAGGAGGCGGCCCGCCGCGGCAGCTCGTCGAGCGACTCGCGCGAGCCCTTGTCCCTGACGGGCCGGCGGCGC
AGCTCCGCGGCCGGCCACGGCGCGTCCCTGTTCGGCCCGGCGGCGGCGCAGTGA
Gene >Hirsu2|1071
ATGTTTTCTCCCTCGACCGCTCAGGGGGGCCCCGCGACGGCAACCCGATCGCGCCGTCGCCAGCGACCCAAGAGC
TCGGAAAGCCTGGTCCAGCAGCCCAAGGCCAAACGACAGCGCGTCCCGCTGACGGAGCAGACCTTCATCAACCCC
GAGCCCCAACCGGAGACGGTCGACCTCAAGGCAGAAAAGGTGCCGGCGGCCGATGCGAAGAACGACGTGTCCATG
GATGATGTCCATCATGCCTCTCGCAAGGAACTGCCTGTGCGGGCCAAAAAGTCCAAGCACAGCGATCGAGCTGCG
AATAAGGGCGATGGCAGCCTCGTCTTGGTTCGTGCACCGCCGGCCGTCCNNNNNNNNCCCCCCCCCCCCCCCCCG
CGAAGGCTCAACACTATGCTAATCCCTCGTCCTTTTGCTACAGGCGAGCACAAATGCCTTCACTGTTTCGAAGCT
GCCTGCGCTGCCGGACAGGATAAGGTCGGATTGGTCGGGTATGCATCGCTCTCGCGCCCGCCAGACGTCCCGAGC
TGACCGATTTTTCCTCCCCAGGGAATCAACACGCCGAGATCTTTTCGCCATCCGGATTCGCCCTGACTCTAACGT
CGACGCACGCCATCGTCTGGCCCTACAACGCGACGTCGCAATCGCCCGAAACATTCACATTCACTTTGCCTTCCG
CTTCGAAACCCAGCGACCCTCTGCCCGTAGGATGCCTTGTCTCCCCGTCAGCCTCGTCGACCGAACCCGGGCTGG
TCGTTGTCATGTCCGGCAGCGGCAAAGTTGTGTACTGGGAGTCCATCTCCAGCGCCGCCACCTTCGCCTTCATCA
AAAAGGATCGATCCGGCGTCGAACACATGATATCCGGCATGTCTTCGGGAGAAAAGGTCATTTCCATCACCAACG
CCGAGTCCGCAGGCTTCATCTTGACCTTCAGCACCGGACGCCTGGCATACATGAGTGTCAGGGATGGCCACGGAC
GCCCCGCGATTTCGATCCAGTTCCTGCGCGCCGGCCCGGCGACCTCGGGCACCAGCCTGTTCGGCAGCATTCGCC
ACGCCTTCTCGCACCTCTCCCCCCGCGGAGACATCGCCGCCGTCCGCGCCGATCGCTCGGCCCGTGTCGGCGAAC
GCAGCATCGTCTCGCTCAGCAGCAAGGGCAAACTGCAGTCCTGGATGGTTCACCGCGGCGGCCATCACGAGCCTG
TCGGCGAGGCCGAAGTGCGAGAGCGTCTGGTTGCGGCTCTTCAGGATACCGACCGCGCGAGCCAGGAGTTCCCGG
CCGAGTCCTTCGAAGCCCTGGACTTCGTCTACGTCCCCAAAGGTCTGGAGCACAAGTACCTGAAGCTGAGCAGGC
TGAGCGACGCCATGGCTTCCGACAGCCCCAGCGTGCAGCACTTGCTGCTGCTCGTCAGCCTGACCTCCAAGGGAG
TGTCACGATACATGCTGGTCGAAACCATATTGACGCCCAGCGACTGCCAGATCGGCATGATACGACCGATCACCT
CCTACTCGACCCCTTGGACCCAGGCCGACTCGGCACAGAGCACGAGGCCCCGCATCTACCTGCCGCGCCCGGCCC
TCGTGGCGTTCGTCGTCTTCGACCACGCTGCCATCGTCGCATCGGTCGCCATTCCTCCCGAGTCCCCCGAGTCCC
AGCTCCAGACCGACAGCCATATCTTGCCGGCTTCGTTCGAGGATGTTGTCGATTTTAGGGAAGACAACGTGCACG
AAATTGTCGGCTCCGGCTTCGAAGAGACTCCTGCAGTCTCTGGCGGACACGATGAGAACCGAGCGGCCCGGCACA
AGACGAAGAACCCGGCCGTCGTCCTCGTCGTGCGAGGCGCGGGAGTCGTGCGAATCCTGACAACGGACGTGGACA
AGTTCGCCAGCGACCAGCCTCCCCGGGTTTCGGCTAAGAGCAAGCTGGAGCAGGCCGTCTTCTTCGGCACCAAGA
AGGACAATCCTCTGGTATTCGACGGGCGGCAGGACTTCAACTTTACGAACGAGGAGATCGCCGACGCGGCGCTCG
AGGTCAGCCACGAGATCCTCAGCTCGACGACGTCGTACCTGTCCACGTTGCCGGCGTCCATGGAGGAGAACTTGC
GTGCTCGGTCCAACGCGCTCGAGAGACTGATGCTACACCTCCGAGCCATCGGCGTCGATCTGGATCGCAAGACGC
GCTGGAAGCTCCTCTACAACGCGGAGAAGATGCATGTTGCCACCATACTGTGGAGGCGGCACGAGGCCTTCACCG
CGAGGCGGCCCGCGGACGACAAGAAGAGCTTGGTCGGCTCCATCGTCGAGTTCATCCACGAGGTCCACGATTGCC
ACCCCAACAGGAACATTGGCGAGCTGGACGCGGTGAGGCACTGGTTCTCCAACGACATCTACCGCCTCGAGATTT
TCGTATCTTGGGCCTACGAAGTGATCAAGGTCCTGTACAAGGACGAGCTTCTCGATGAGACCAGGATGACCGTCA
TGCTGCACGAGGCAATGCACATTAACATCAGCGCCCATTCCGGAGCACACGACTTCCGCCGGAGCAACTTGTCCT
TTTACGGCCTCGGCCAGGAACAGCTTCGGATGGGCATCCTGCGCGACGGCTACGAAGACCTACCGGAGCCGTGGA
CCGGCAACCCCTTCCTCGCAAACAACTCCAAGCGCTTGACGGATCTGTGCGAACAATGGCTGCAGAGCTACGAGA
AGTCGCGAAAGACGAAGCTCGTGTCCAAGCCACCAGCTTCCAGCGGGGTCGCCATGATCTACGATGACATGCCCG
CCTTAGTCGACGGCATGCTGACCGCCGTGCTGGAATACGCTCGCTGGGGAACGGCGAATTGCGACCGCCACGAAC
TGGCCAATTCCGACCGCAAGGGGTTGCCCAAGGACTACGCCAAGACCTACGACACGGAACGACACGACAAGCCCG
TATCGCTGGCCCGGTTCGGCAAGTGGGAGCAGGGCGCCAAGATTGCCGAGAAGCACGGCTGCCTCAGCGGCCTGG
CCGTGATCCTGCTGGAGCACATCGAGATGCTGGAGTCTCAGCTGTCGGAGCCAGGCCTCTCGGCGGCGGAGACGA
CGAGCTTGCGGGCCGCCCGACAGGCGAAGAAGACGCAGATGGAGGACTCGTTCGGCAAATACGGCGAGCCCTTTG
CCTTCCCCGTATACGAGACACTACTCGAAAAGCACGGGGTGGCGGCTGTGTTGGAGTTCGAGCTGGACACGCTCG
GCTTCAAGACTCGATTTCTCCGGAGCAGGCCGGGCCTGGCCCGCATATCTTGGATCAACGACATCCAGCAGGAGA
AGGACGTCGACCACGCGGCCGACACACTGATGAGCCTCGCACTCACGGCAGAGGACCAGGTGTGGAAGAAGAAGA
TTGAGCTGAGTCTGGGCAAGCTCGCTCTTCTGGCCGAGGCCGAGACGGAGCCGCAGCCGCAGCAGCATTCCTTCA
CGGTCAAGTCGGACGCGGCTGTTCGCGAGAAGAAGCTGGAGCGGGTCGAGAAGGAGCTGATCATGGTCAGGATCC
AGGACTGCCTGTACAACCAGATCCTGCCCAGCACGTACGACGCCGTCGACAGCGCGGCCGCCCTCAACTTCGCCC
TCGAGCTCCACAGCACCAACGTCCCCCGGCGGCAAAAGGCACTTCTGCAACTCTTCACCGACGGCATGGCGAAGC
TGCTGGACCACCAGGCCCTCGATGCCATGAGCCTCATCGACCTGCTGACCCTGGTGGCGCTCGGCCCGGAGTCGA
GGGAGGAGATTGTGCACCCGTTCTGGATGGCGCTGAAGGTGGCAGACAGCGCCTGCCACTCGGACGAGGTCCGGG
ACGCCAAGAAGCTGATCTGGCGACGGCTGTTCATCCGCGACGACTGGGCCAAGCTCAACGACACGCAGCTCAAGG
ACGACGTCGAGGTCGTGAGCCGGATCGCGGAGACGGAGCTGTGCGCCATGTTCACCGACTGCATCCGATACCGTA
AGTGCCCCCCCCTCTCCTCCTGGACCGCGCGGACGACGTGTGCTGACGGCGGGGCAACAGAGGACCCCAAGGAGC
CGTTCCGATACGTCGAGCCTCAGGAGGTGCTCGGCGTCTTCACCGAGACGCTCGACCGGCGCTTCCAGAACTTTG
CCGACAACGAGCAGGCCAAGCTGGTGGAGGCGATGCGGTGGGAGGACAAGGTGCTGGCGCAGTACATGGAGAAGA
ACCGGCTCAGCAAGTGGGTGCAGACGGCGTACGAGACGGCGCAGACCGAGGTGGAGAGCCTGGCGGAGGAGGCGG
CCCGCCGCGGCAGCTCGTCGAGCGACTCGCGCGAGCCCTTGTCCCTGACGGGCCGGCGGCGCAGCTCCGCGGCCG
GCCACGGCGCGTCCCTGTTCGGCCCGGCGGCGGCGCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail