Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10707
Gene name
LocationContig_893:8716..9331
Strand+
Gene length (bp)615
Transcript length (bp)516
Coding sequence length (bp)516
Protein length (aa) 172

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12273 RCR Chitin synthesis regulation, resistance to Congo red 1.4E-25 34 169

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03446|RCR2_YEAST Protein RCR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCR2 PE=1 SV=1 32 75 2.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10707
MAPTSVVKLMARYVECDITGRCYRRNSRWYDWGRWILIGILLLGLLLVLFSLSCIARRRRRRGAQPLYGTGWMAP
AGKFGGHNSQQPMNTYQQGYDGQGYGPQGGYPPAPPAYGQPQHAQYTGTTGTTFNPNDGYYGDPAQQQQHYGVQQ
PPNAYQPNSPYSPPAGPPPGK*
Coding >Hirsu2|10707
ATGGCGCCCACGTCGGTAGTCAAGCTGATGGCGCGCTACGTTGAGTGCGACATCACCGGTCGCTGCTACAGACGG
AACAGCCGCTGGTACGACTGGGGTCGATGGATCTTGATCGGCATCCTCCTGCTGGGCCTCCTCCTCGTCCTGTTC
TCGTTGTCATGCATCGCCCGTCGCCGCCGTCGCCGCGGTGCGCAGCCGCTGTACGGCACTGGCTGGATGGCGCCG
GCCGGCAAGTTCGGCGGCCACAACTCGCAGCAGCCCATGAACACGTACCAGCAGGGCTACGACGGCCAGGGCTAC
GGCCCGCAGGGTGGCTACCCCCCGGCGCCGCCGGCGTACGGCCAGCCGCAGCACGCGCAGTACACGGGCACGACG
GGCACGACCTTCAACCCCAACGACGGCTACTACGGCGACCCGGCGCAGCAGCAGCAGCACTACGGCGTCCAGCAG
CCGCCCAACGCCTACCAGCCGAATTCCCCCTACTCGCCTCCCGCCGGCCCGCCGCCCGGCAAGTAG
Transcript >Hirsu2|10707
ATGGCGCCCACGTCGGTAGTCAAGCTGATGGCGCGCTACGTTGAGTGCGACATCACCGGTCGCTGCTACAGACGG
AACAGCCGCTGGTACGACTGGGGTCGATGGATCTTGATCGGCATCCTCCTGCTGGGCCTCCTCCTCGTCCTGTTC
TCGTTGTCATGCATCGCCCGTCGCCGCCGTCGCCGCGGTGCGCAGCCGCTGTACGGCACTGGCTGGATGGCGCCG
GCCGGCAAGTTCGGCGGCCACAACTCGCAGCAGCCCATGAACACGTACCAGCAGGGCTACGACGGCCAGGGCTAC
GGCCCGCAGGGTGGCTACCCCCCGGCGCCGCCGGCGTACGGCCAGCCGCAGCACGCGCAGTACACGGGCACGACG
GGCACGACCTTCAACCCCAACGACGGCTACTACGGCGACCCGGCGCAGCAGCAGCAGCACTACGGCGTCCAGCAG
CCGCCCAACGCCTACCAGCCGAATTCCCCCTACTCGCCTCCCGCCGGCCCGCCGCCCGGCAAGTAG
Gene >Hirsu2|10707
ATGGCGCCCACGTCGGTAGTCAAGCTGATGGCGCGCTACGTTGAGTGCGACATCACCGGTCGCTGCTACAGACGG
AACAGCCGCTGGTACGACTGGGGTCGATGGATCTTGATCGGCATCCTCCTGCTGGGCCTCCTCCTCGTCCTGTTC
TCGTTGTCGTGAGTTTGGCCCCCCCCCCTGTTCGTCCACTTGTCGCTCCCTTCCCCCTCTTCCGCTGCCCATGCC
GGGAGCGCTGACGTGGGCTGTGACACGGCCAGATGCATCGCCCGTCGCCGCCGTCGCCGCGGTGCGCAGCCGCTG
TACGGCACTGGCTGGATGGCGCCGGCCGGCAAGTTCGGCGGCCACAACTCGCAGCAGCCCATGAACACGTACCAG
CAGGGCTACGACGGCCAGGGCTACGGCCCGCAGGGTGGCTACCCCCCGGCGCCGCCGGCGTACGGCCAGCCGCAG
CACGCGCAGTACACGGGCACGACGGGCACGACCTTCAACCCCAACGACGGCTACTACGGCGACCCGGCGCAGCAG
CAGCAGCACTACGGCGTCCAGCAGCCGCCCAACGCCTACCAGCCGAATTCCCCCTACTCGCCTCCCGCCGGCCCG
CCGCCCGGCAAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail