Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10706
Gene name
LocationContig_893:6027..7572
Strand+
Gene length (bp)1545
Transcript length (bp)1179
Coding sequence length (bp)1179
Protein length (aa) 393

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03151 TPT Triose-phosphate Transporter family 5.1E-16 59 330

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 62 342 8.0E-48
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 62 335 3.0E-47
sp|Q9SUV2|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana GN=At4g32390 PE=3 SV=1 62 342 2.0E-46
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 62 342 9.0E-45
sp|Q9LRP2|PT317_ARATH Probable sugar phosphate/phosphate translocator At3g17430 OS=Arabidopsis thaliana GN=At3g17430 PE=1 SV=1 73 341 8.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3E6T0|PT525_ARATH Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana GN=At5g25400 PE=2 SV=1 62 342 8.0E-48
sp|Q9LFN3|PT511_ARATH Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana GN=At5g11230 PE=2 SV=1 62 335 3.0E-47
sp|Q9SUV2|PT432_ARATH Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana GN=At4g32390 PE=3 SV=1 62 342 2.0E-46
sp|Q9SKJ7|PT225_ARATH Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana GN=At2g25520 PE=1 SV=1 62 342 9.0E-45
sp|Q9LRP2|PT317_ARATH Probable sugar phosphate/phosphate translocator At3g17430 OS=Arabidopsis thaliana GN=At3g17430 PE=1 SV=1 73 341 8.0E-41
sp|Q9C8M1|PT153_ARATH Probable sugar phosphate/phosphate translocator At1g53660 OS=Arabidopsis thaliana GN=At1g53660 PE=3 SV=2 73 330 8.0E-35
sp|Q9LNH5|PT148_ARATH Probable sugar phosphate/phosphate translocator At1g48230 OS=Arabidopsis thaliana GN=At1g48230 PE=2 SV=2 73 341 5.0E-34
sp|Q94EI9|PT314_ARATH Probable sugar phosphate/phosphate translocator At3g14410 OS=Arabidopsis thaliana GN=At3g14410 PE=2 SV=1 73 347 2.0E-33
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 52 340 5.0E-20
sp|Q9LDH3|PT112_ARATH Probable sugar phosphate/phosphate translocator At1g12500 OS=Arabidopsis thaliana GN=At1g12500 PE=1 SV=1 59 330 4.0E-19
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 60 340 4.0E-19
sp|Q9NQQ7|S35C2_HUMAN Solute carrier family 35 member C2 OS=Homo sapiens GN=SLC35C2 PE=1 SV=2 75 326 2.0E-18
sp|Q9FYE5|PT504_ARATH Probable sugar phosphate/phosphate translocator At5g04160 OS=Arabidopsis thaliana GN=At5g04160 PE=2 SV=1 53 329 2.0E-16
sp|Q6DBP3|PT505_ARATH Probable sugar phosphate/phosphate translocator At5g05820 OS=Arabidopsis thaliana GN=At5g05820 PE=2 SV=1 61 330 5.0E-16
sp|Q9SS40|PT310_ARATH Probable sugar phosphate/phosphate translocator At3g10290 OS=Arabidopsis thaliana GN=At3g10290 PE=3 SV=1 61 329 5.0E-16
sp|Q8VCX2|S35C2_MOUSE Solute carrier family 35 member C2 OS=Mus musculus GN=Slc35c2 PE=1 SV=1 75 355 4.0E-15
sp|Q5XF09|PT311_ARATH Probable sugar phosphate/phosphate translocator At3g11320 OS=Arabidopsis thaliana GN=At3g11320 PE=2 SV=1 52 330 2.0E-14
sp|Q8H184|PT106_ARATH Probable sugar phosphate/phosphate translocator At1g06470 OS=Arabidopsis thaliana GN=At1g06470 PE=2 SV=1 29 342 2.0E-13
sp|Q10354|YDB1_SCHPO Uncharacterized transporter C22E12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22E12.01 PE=3 SV=2 60 344 6.0E-10
sp|Q5VQL3|PPT3_ORYSJ Phosphoenolpyruvate/phosphate translocator 3, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT3 PE=2 SV=1 50 330 3.0E-09
sp|Q9FTT3|TPT_ORYSJ Triose phosphate/phosphate translocator TPT, chloroplastic OS=Oryza sativa subsp. japonica GN=TPT PE=2 SV=1 19 342 8.0E-08
sp|P0CK96|S352B_HUMAN Solute carrier family 35 member E2B OS=Homo sapiens GN=SLC35E2B PE=2 SV=1 65 343 2.0E-07
sp|P11869|TPT_SPIOL Triose phosphate/phosphate translocator, chloroplastic OS=Spinacia oleracea PE=1 SV=1 44 344 3.0E-07
sp|P52177|TPT1_BRAOB Triose phosphate/phosphate translocator, chloroplastic OS=Brassica oleracea var. botrytis GN=TPT PE=2 SV=1 42 341 7.0E-07
sp|P21727|TPT_PEA Triose phosphate/phosphate translocator, chloroplastic OS=Pisum sativum PE=1 SV=1 21 341 2.0E-06
sp|Q9ZSR7|TPT_ARATH Triose phosphate/phosphate translocator TPT, chloroplastic OS=Arabidopsis thaliana GN=TPT PE=1 SV=1 33 341 3.0E-06
sp|P49132|TPT_FLATR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria trinervia GN=TPT PE=2 SV=1 5 341 4.0E-06
sp|P49131|TPT_FLAPR Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria pringlei GN=TPT PE=2 SV=1 5 344 4.0E-06
sp|P49133|TPT_MAIZE Triose phosphate/phosphate translocator, chloroplastic OS=Zea mays GN=TPT PE=1 SV=1 65 341 7.0E-06
sp|Q84QU8|PPT2_ORYSJ Phosphoenolpyruvate/phosphate translocator 2, chloroplastic OS=Oryza sativa subsp. japonica GN=PPT2 PE=2 SV=1 37 330 8.0E-06
sp|Q8RXL8|Y1689_ARATH Uncharacterized membrane protein At1g06890 OS=Arabidopsis thaliana GN=At1g06890 PE=1 SV=1 76 342 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 87 109 22
3 129 151 22
4 163 182 19
5 192 214 22
6 226 248 22
7 258 280 22
8 285 307 22
9 311 333 22
10 354 376 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10706
MAAPLDEGSSASPSPMPSRPPVLPVASCSSSPSAALAIGDKEAAALEGPGEARGGLHPALLIANWMFFSNLTIVF
NKWIIDSAGFRYPVFLTCWHLVFSTKLCMTPSLYLRTVCPIGVLYSASLVCSNLAYLYLSVPFIQILKSSSPVAV
LLASWAWRLADPSLGTLGNVLFVTAGIAVASVGEIHFSLTGFLYQIGGLVFGAVQLVMTELMLGARSLHAHPLVS
LYYYAPVCAGTYLAVALVVELPVFDWADLVRVGPGMLLLNAMVAFALNFAGVFLISKTSSLVMALAGILKNILLI
AASALIWKTQVTAMQAAGYSMALSGLVYYSFGYAQLAEAAQAVNVWTAAGLRPLRGCRLLLVGLVVLVALSILWI
HGAEPRDGALPTSSAGS*
Coding >Hirsu2|10706
ATGGCGGCCCCGCTGGACGAAGGCTCGTCGGCCTCGCCTTCGCCCATGCCGTCTCGGCCGCCCGTCCTCCCCGTC
GCCTCCTGCTCTTCCTCGCCGTCGGCGGCGCTCGCGATCGGCGACAAGGAGGCGGCGGCGCTCGAGGGGCCCGGG
GAGGCCCGAGGTGGGCTGCATCCGGCCCTGCTCATTGCCAACTGGATGTTCTTTTCGAACCTGACCATCGTCTTC
AACAAGTGGATCATCGACTCCGCCGGCTTCAGATACCCCGTCTTCCTCACCTGCTGGCACCTCGTCTTCTCGACC
AAGCTGTGCATGACGCCGTCTCTGTACCTGCGCACCGTCTGTCCCATCGGCGTCTTGTACTCGGCCTCGCTCGTC
TGCTCGAACCTGGCGTACCTGTACCTCTCGGTGCCCTTCATCCAGATCCTCAAGTCGTCGTCGCCCGTCGCCGTC
CTGCTCGCCTCGTGGGCGTGGCGGCTCGCCGACCCTAGCCTCGGCACGCTCGGCAACGTCCTGTTCGTCACGGCC
GGCATCGCCGTGGCCTCGGTCGGCGAGATCCACTTCTCCCTGACCGGCTTCCTCTACCAGATCGGCGGCCTCGTC
TTCGGGGCCGTGCAGCTCGTCATGACGGAGCTCATGCTCGGGGCCCGGTCCCTGCACGCCCACCCGCTCGTCAGC
CTGTACTACTACGCGCCCGTCTGCGCCGGCACCTATCTCGCCGTCGCCCTGGTCGTCGAGCTGCCCGTCTTCGAC
TGGGCCGACCTCGTCCGCGTCGGGCCCGGCATGCTACTTCTCAACGCCATGGTGGCCTTTGCGCTCAACTTTGCC
GGCGTCTTCCTCATAAGCAAGACGTCCAGCCTCGTCATGGCCCTGGCCGGCATCCTCAAGAATATCCTTCTCATC
GCCGCCTCGGCCCTCATCTGGAAGACCCAAGTCACCGCGATGCAGGCCGCCGGCTACTCCATGGCCTTGAGTGGT
CTCGTCTACTACTCCTTCGGCTACGCGCAACTGGCGGAAGCCGCCCAGGCCGTCAATGTCTGGACCGCGGCCGGC
CTCCGGCCTCTTCGCGGATGTAGGCTGCTTCTGGTCGGTCTCGTCGTGCTCGTTGCGCTTTCGATTCTTTGGATC
CATGGCGCCGAGCCTCGGGACGGCGCTTTGCCGACATCCTCTGCCGGGTCCTAG
Transcript >Hirsu2|10706
ATGGCGGCCCCGCTGGACGAAGGCTCGTCGGCCTCGCCTTCGCCCATGCCGTCTCGGCCGCCCGTCCTCCCCGTC
GCCTCCTGCTCTTCCTCGCCGTCGGCGGCGCTCGCGATCGGCGACAAGGAGGCGGCGGCGCTCGAGGGGCCCGGG
GAGGCCCGAGGTGGGCTGCATCCGGCCCTGCTCATTGCCAACTGGATGTTCTTTTCGAACCTGACCATCGTCTTC
AACAAGTGGATCATCGACTCCGCCGGCTTCAGATACCCCGTCTTCCTCACCTGCTGGCACCTCGTCTTCTCGACC
AAGCTGTGCATGACGCCGTCTCTGTACCTGCGCACCGTCTGTCCCATCGGCGTCTTGTACTCGGCCTCGCTCGTC
TGCTCGAACCTGGCGTACCTGTACCTCTCGGTGCCCTTCATCCAGATCCTCAAGTCGTCGTCGCCCGTCGCCGTC
CTGCTCGCCTCGTGGGCGTGGCGGCTCGCCGACCCTAGCCTCGGCACGCTCGGCAACGTCCTGTTCGTCACGGCC
GGCATCGCCGTGGCCTCGGTCGGCGAGATCCACTTCTCCCTGACCGGCTTCCTCTACCAGATCGGCGGCCTCGTC
TTCGGGGCCGTGCAGCTCGTCATGACGGAGCTCATGCTCGGGGCCCGGTCCCTGCACGCCCACCCGCTCGTCAGC
CTGTACTACTACGCGCCCGTCTGCGCCGGCACCTATCTCGCCGTCGCCCTGGTCGTCGAGCTGCCCGTCTTCGAC
TGGGCCGACCTCGTCCGCGTCGGGCCCGGCATGCTACTTCTCAACGCCATGGTGGCCTTTGCGCTCAACTTTGCC
GGCGTCTTCCTCATAAGCAAGACGTCCAGCCTCGTCATGGCCCTGGCCGGCATCCTCAAGAATATCCTTCTCATC
GCCGCCTCGGCCCTCATCTGGAAGACCCAAGTCACCGCGATGCAGGCCGCCGGCTACTCCATGGCCTTGAGTGGT
CTCGTCTACTACTCCTTCGGCTACGCGCAACTGGCGGAAGCCGCCCAGGCCGTCAATGTCTGGACCGCGGCCGGC
CTCCGGCCTCTTCGCGGATGTAGGCTGCTTCTGGTCGGTCTCGTCGTGCTCGTTGCGCTTTCGATTCTTTGGATC
CATGGCGCCGAGCCTCGGGACGGCGCTTTGCCGACATCCTCTGCCGGGTCCTAG
Gene >Hirsu2|10706
ATGGCGGCCCCGCTGGACGAAGGCTCGTCGGCCTCGCCTTCGCCCATGCCGTCTCGGCCGCCCGTCCTCCCCGTC
GCCTCCTGCTCTTCCTCGCCGTCGGCGGCGCTCGCGATCGGCGACAAGGAGGCGGCGGCGCTCGAGGGGCCCGGG
GAGGCCCGAGGTGGGCTGCATCCGGCCCTGCTCATTGCGTGCGTTGGCGCCCCTTCTTCAACCAGACGCAAGTGA
CTTGGTCGTCGTGACGCTGACGATGAGACCGGCGGAACACACAGCAACTGGATGTTCTTTTCGAACCTGACCATC
GTCTTCAACAAGTGGATCATCGACTCCGCCGGCTTCAGTGAGTACAGACGTCTGGCAACTGTGGCAACCCGGACA
TGGCTGACCGCCCAGCAGGATACCGTACGTCTTCCACCGCTTTCTCCCATGGGGGGCCTCACGATACGTCGAAAC
CGACGCCAGGCAGAACAAAGGGGGGGGGGGGAAGAAAGGAGTGTTGCTGACACCGCCTGCAGCCGTCTTCCTCAC
CTGCTGGCACCTCGTCTTCTCGACCGTCGCGACGCAGAAACTTGGCCCGGACGACGGGGCTGATCCCGTGCCAGA
AGCTGTGCATGACGCCGTCTCTGTACCTGCGCACCGTCTGTCCCATCGGCGTCTTGTACTCGGCCTCGCTCGTCT
GCTCGAACCTGGCGTACCTGTACCTCTCGGTGCCCTTCATCCAGATCCTCAAGTCGTCGTCGCCCGTCGCCGTCC
TGCTCGCCTCGTGGGCGTGGCGGCTCGCCGACCCTAGCCTCGGCACGCTCGGCAACGTCCTGTTCGTCACGGCCG
GCATCGCCGTGGCCTCGGTCGGCGAGATCCACTTCTCCCTGACCGGCTTCCTCTACCAGATCGGCGGCCTCGTCT
TCGGGGCCGTGCAGCTCGTCATGACGGAGCTCATGCTCGGGGCCCGGTCCCTGCACGCCCACCCGCTCGTCAGCC
TGTACTACTACGCGCCCGTCTGCGCCGGCACCTATCTCGCCGTCGCCCTGGTCGTCGAGCTGCCCGTCTTCGACT
GGGCCGACCTCGTCCGCGTCGGGCCCGGCATGCTACTTCTCAACGCCATGGTGGCCTTTGCGCTCAACTTTGCCG
GCGTCTTCCTCGTGAGTGTGGTCTGGGCAGCGTCCTGTCGCCGCAGCGGCTCGTACGTGGCTGACGACGCCCTCG
CAGATAAGCAAGACGTCCAGCCTCGTCATGGCCCTGGCCGGCATCCTCAAGAATATCCTTCTCATCGCCGCCTCG
GCCCTCATCTGGAAGACCCAAGTCACCGCGATGCAGGCCGCCGGCTACTCCATGGCCTTGAGTGGTCTCGTCTAC
TACTCCTTCGGCTACGCGCAACTGGCGGAAGCCGCCCAGGCCGTCAATGTCTGGACCGCGGCCGGCCTCCGGCCT
CTTCGCGGATGTAGGCTGCTTCTGGTCGGTCTCGTCGTGCTCGTTGCGCTTTCGATTCTTTGGATCCATGGCGCC
GAGCCTCGGGACGGCGCTTTGCCGACATCCTCTGCCGGGTCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail