Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10704
Gene name
LocationContig_893:149..1151
Strand-
Gene length (bp)1002
Transcript length (bp)723
Coding sequence length (bp)723
Protein length (aa) 241

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5583 0.5392 0.1477 0.0788 0.1479 0.0408 0.1171 0.1363 0.0857 0.0062

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3167
Ophiocordyceps australis 1348a (Ghana) OphauG2|7635
Ophiocordyceps australis map64 (Brazil) OphauB2|4183
Ophiocordyceps australis map64 (Brazil) OphauB2|4293
Ophiocordyceps australis map64 (Brazil) OphauB2|645
Ophiocordyceps camponoti-floridani Ophcf2|05732
Ophiocordyceps camponoti-floridani Ophcf2|07416
Ophiocordyceps camponoti-floridani Ophcf2|06975
Ophiocordyceps camponoti-floridani Ophcf2|06825
Ophiocordyceps camponoti-floridani Ophcf2|06356
Ophiocordyceps camponoti-floridani Ophcf2|06020
Ophiocordyceps camponoti-floridani Ophcf2|04973
Ophiocordyceps camponoti-floridani Ophcf2|03672
Ophiocordyceps camponoti-floridani Ophcf2|03426
Ophiocordyceps camponoti-floridani Ophcf2|02741
Ophiocordyceps camponoti-floridani Ophcf2|02076
Ophiocordyceps camponoti-floridani Ophcf2|01686
Ophiocordyceps camponoti-floridani Ophcf2|01556
Ophiocordyceps camponoti-floridani Ophcf2|00991
Ophiocordyceps camponoti-floridani Ophcf2|00845
Ophiocordyceps camponoti-floridani Ophcf2|00452
Ophiocordyceps camponoti-floridani Ophcf2|00414
Ophiocordyceps camponoti-floridani Ophcf2|00412
Ophiocordyceps camponoti-rufipedis Ophun1|1759
Ophiocordyceps camponoti-rufipedis Ophun1|1629
Ophiocordyceps camponoti-rufipedis Ophun1|1829
Ophiocordyceps camponoti-rufipedis Ophun1|2131
Ophiocordyceps camponoti-rufipedis Ophun1|2141
Ophiocordyceps camponoti-rufipedis Ophun1|2419
Ophiocordyceps camponoti-rufipedis Ophun1|2763
Ophiocordyceps camponoti-rufipedis Ophun1|727
Ophiocordyceps camponoti-rufipedis Ophun1|4236
Ophiocordyceps camponoti-rufipedis Ophun1|6845
Ophiocordyceps camponoti-rufipedis Ophun1|4243
Ophiocordyceps camponoti-rufipedis Ophun1|5577
Ophiocordyceps camponoti-rufipedis Ophun1|1565
Ophiocordyceps camponoti-rufipedis Ophun1|6641
Ophiocordyceps camponoti-rufipedis Ophun1|3654
Ophiocordyceps kimflemingae Ophio5|7949
Ophiocordyceps kimflemingae Ophio5|3591
Ophiocordyceps kimflemingae Ophio5|7259
Ophiocordyceps kimflemingae Ophio5|7113
Ophiocordyceps kimflemingae Ophio5|7005
Ophiocordyceps kimflemingae Ophio5|6824
Ophiocordyceps kimflemingae Ophio5|604
Ophiocordyceps kimflemingae Ophio5|5925
Ophiocordyceps kimflemingae Ophio5|576
Ophiocordyceps kimflemingae Ophio5|5274
Ophiocordyceps kimflemingae Ophio5|4675
Ophiocordyceps kimflemingae Ophio5|3913
Ophiocordyceps kimflemingae Ophio5|2012
Ophiocordyceps kimflemingae Ophio5|1712
Ophiocordyceps kimflemingae Ophio5|7690
Ophiocordyceps subramaniannii Hirsu2|10704 (this protein)
Ophiocordyceps subramaniannii Hirsu2|10673

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10704
MATGGFQPQGEGWQNYHESFSISRHIEAGPSGCFLEEAEGNPNFEFRTAYVSTTTQQVVASYGTWLYEIRATPNM
FDWDQNDDLRGQTTEAIESDADDSSSDDSDEESDDDEEMSAARYARWFMRDSVLIDMLGPFPFDFLPPAHPIPAP
PTEQGPQQPVPTTSPNAQVERWGQDLLRCYFRQGADRARDVFPGICVGSGKKIATDNLVEEPLQLEHAEEGQTQT
LITEYIDNPWLWHQE*
Coding >Hirsu2|10704
ATGGCGACCGGTGGTTTTCAACCCCAGGGCGAAGGCTGGCAAAACTATCACGAGTCGTTCAGCATCTCCCGTCAT
ATCGAGGCAGGCCCGAGCGGCTGTTTTCTGGAGGAAGCAGAGGGAAACCCCAACTTTGAATTCCGAACCGCTTAT
GTATCGACGACAACCCAACAGGTTGTCGCATCGTACGGTACCTGGCTCTACGAGATTCGCGCCACACCAAACATG
TTCGACTGGGACCAGAATGACGACCTGAGAGGACAAACAACCGAAGCGATCGAGTCCGATGCCGACGACTCGAGC
TCTGACGATTCGGACGAAGAAAGTGACGACGACGAAGAAATGAGCGCCGCCCGTTACGCGCGGTGGTTCATGCGT
GATTCCGTGTTGATAGACATGCTGGGCCCTTTTCCTTTTGACTTCCTTCCACCGGCACACCCGATCCCCGCGCCA
CCGACTGAGCAGGGCCCCCAACAGCCCGTGCCGACGACCTCCCCCAACGCGCAGGTTGAGAGGTGGGGACAGGAC
CTTCTGCGGTGCTATTTTCGTCAAGGCGCCGACAGAGCGCGCGACGTGTTCCCTGGTATATGCGTTGGCTCCGGA
AAGAAAATCGCGACGGACAACCTCGTCGAAGAGCCTTTGCAATTGGAGCACGCAGAGGAAGGCCAAACTCAGACT
CTCATAACCGAATACATCGACAACCCTTGGCTCTGGCATCAGGAGTAG
Transcript >Hirsu2|10704
ATGGCGACCGGTGGTTTTCAACCCCAGGGCGAAGGCTGGCAAAACTATCACGAGTCGTTCAGCATCTCCCGTCAT
ATCGAGGCAGGCCCGAGCGGCTGTTTTCTGGAGGAAGCAGAGGGAAACCCCAACTTTGAATTCCGAACCGCTTAT
GTATCGACGACAACCCAACAGGTTGTCGCATCGTACGGTACCTGGCTCTACGAGATTCGCGCCACACCAAACATG
TTCGACTGGGACCAGAATGACGACCTGAGAGGACAAACAACCGAAGCGATCGAGTCCGATGCCGACGACTCGAGC
TCTGACGATTCGGACGAAGAAAGTGACGACGACGAAGAAATGAGCGCCGCCCGTTACGCGCGGTGGTTCATGCGT
GATTCCGTGTTGATAGACATGCTGGGCCCTTTTCCTTTTGACTTCCTTCCACCGGCACACCCGATCCCCGCGCCA
CCGACTGAGCAGGGCCCCCAACAGCCCGTGCCGACGACCTCCCCCAACGCGCAGGTTGAGAGGTGGGGACAGGAC
CTTCTGCGGTGCTATTTTCGTCAAGGCGCCGACAGAGCGCGCGACGTGTTCCCTGGTATATGCGTTGGCTCCGGA
AAGAAAATCGCGACGGACAACCTCGTCGAAGAGCCTTTGCAATTGGAGCACGCAGAGGAAGGCCAAACTCAGACT
CTCATAACCGAATACATCGACAACCCTTGGCTCTGGCATCAGGAGTAG
Gene >Hirsu2|10704
ATGGCGACCGGTGGTTTTCAACCCCAGGGCGAAGGCTGGCAAAACTATCACGAGTCGTTCAGCATCTCCCGTCAT
ATCGAGGCAGGCCCGAGCGGCTGTTTTCTGGAGGAAGCAGAGGGAAACCCCAACTTTGAATTCCGAACCGCTTAT
GTATCGACGACAACCCAACAGGTTGTCGCATCGTACGGTACCTGGCTCTACGAGATTCGCGCCACACCAAACATG
TTCGACTGGGACCAGAATGACGGTGAGACTCTAGTGTTGGGCGGTATCCCGTAGAGACAAGTGCGCCGTTATGCA
CTCGTTAGGCGCGACCGTCGAGACTCGGACGAAATGGACTCGGGTCACCGCGATCTTGTTTGGGAAGACAATCCA
TCCTACGACAGGGAAACGTTCGAAAATAGCTCCTTTGCCTTCGAATGCGATCCCTCGACATGCACGCCAGACCAA
CTATATACATTACAGACCTGAGAGGACAAACAACCGAAGCGATCGAGTCCGATGCCGACGACTCGAGCTCTGACG
ATTCGGACGAAGAAAGTGACGACGACGAAGAAATGAGCGCCGCCCGTTACGCGCGGTGGTTCATGCGTGATTCCG
TGTTGATAGACATGCTGGGCCCTTTTCCTTTTGACTTCCTTCCACCGGCACACCCGATCCCCGCGCCACCGACTG
AGCAGGGCCCCCAACAGCCCGTGCCGACGACCTCCCCCAACGCGCAGGTTGAGAGTAAGACAATGTCCGAGGAGG
CGCGGAGTCATCTTCTCGATTTGATGCTGACTTCTAGCAGGGTGGGGACAGGACCTTCTGCGGTGCTATTTTCGT
CAAGGCGCCGACAGAGCGCGCGACGTGTTCCCTGGTATATGCGTTGGCTCCGGAAAGAAAATCGCGACGGACAAC
CTCGTCGAAGAGCCTTTGCAATTGGAGCACGCAGAGGAAGGCCAAACTCAGACTCTCATAACCGAATACATCGAC
AACCCTTGGCTCTGGCATCAGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail