Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10703
Gene name
LocationContig_892:8844..9574
Strand+
Gene length (bp)730
Transcript length (bp)660
Coding sequence length (bp)660
Protein length (aa) 220

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08229 SHR3_chaperone ER membrane protein SH3 9.3E-75 19 217

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q02774|SHR3_YEAST Secretory component protein SHR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHR3 PE=1 SV=2 16 219 2.0E-25

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 75 97 22
3 104 126 22
4 164 182 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10703
MGAYIDHSKTTKSKDYRGTGSFATFMIIGPTCFFLGILFASFPYDFPLLWTKDPVSDDYYDQLEAHLKFLHQSPP
LIGRLLNIIVSVGFLGLFIKLFRPSEANFLFDGASLILYTIGVAVYISNIVKGLRTLSSGLWDSDEFRHNREGRF
EGEFILGREDSLKVLAASNTILALVLIGVLVLQAGQWYAEKRDSDDEAAAAAEKTEPSPNSKAAAKKKQ*
Coding >Hirsu2|10703
ATGGGCGCCTACATCGACCACTCGAAGACGACCAAGTCCAAGGACTACCGCGGCACCGGGTCGTTTGCGACCTTT
ATGATCATTGGGCCGACGTGCTTCTTCCTCGGCATCCTCTTCGCCTCCTTCCCCTACGACTTCCCCCTCCTCTGG
ACCAAGGACCCGGTCAGCGACGACTACTATGACCAGCTGGAGGCGCACCTCAAGTTCCTGCACCAGTCGCCGCCG
CTCATCGGCCGGCTGCTCAACATCATCGTCAGCGTCGGCTTCCTCGGCCTCTTCATCAAGCTCTTCCGGCCCAGC
GAGGCCAACTTCCTGTTCGACGGCGCGTCGCTGATCCTCTACACCATCGGCGTCGCCGTCTACATCTCCAACATC
GTCAAGGGCCTGCGCACCCTCAGCTCCGGCCTCTGGGACAGCGACGAGTTCCGGCACAACCGCGAGGGGCGCTTC
GAGGGCGAGTTCATCCTCGGCCGCGAGGACAGCCTCAAGGTGCTGGCCGCCAGCAACACCATCCTGGCACTCGTC
CTCATCGGCGTCCTCGTCCTCCAGGCCGGCCAGTGGTACGCGGAGAAGAGGGACTCGGACGACGAGGCCGCCGCC
GCCGCCGAGAAGACGGAGCCGTCGCCCAACAGCAAGGCGGCCGCCAAGAAGAAGCAGTAG
Transcript >Hirsu2|10703
ATGGGCGCCTACATCGACCACTCGAAGACGACCAAGTCCAAGGACTACCGCGGCACCGGGTCGTTTGCGACCTTT
ATGATCATTGGGCCGACGTGCTTCTTCCTCGGCATCCTCTTCGCCTCCTTCCCCTACGACTTCCCCCTCCTCTGG
ACCAAGGACCCGGTCAGCGACGACTACTATGACCAGCTGGAGGCGCACCTCAAGTTCCTGCACCAGTCGCCGCCG
CTCATCGGCCGGCTGCTCAACATCATCGTCAGCGTCGGCTTCCTCGGCCTCTTCATCAAGCTCTTCCGGCCCAGC
GAGGCCAACTTCCTGTTCGACGGCGCGTCGCTGATCCTCTACACCATCGGCGTCGCCGTCTACATCTCCAACATC
GTCAAGGGCCTGCGCACCCTCAGCTCCGGCCTCTGGGACAGCGACGAGTTCCGGCACAACCGCGAGGGGCGCTTC
GAGGGCGAGTTCATCCTCGGCCGCGAGGACAGCCTCAAGGTGCTGGCCGCCAGCAACACCATCCTGGCACTCGTC
CTCATCGGCGTCCTCGTCCTCCAGGCCGGCCAGTGGTACGCGGAGAAGAGGGACTCGGACGACGAGGCCGCCGCC
GCCGCCGAGAAGACGGAGCCGTCGCCCAACAGCAAGGCGGCCGCCAAGAAGAAGCAGTAG
Gene >Hirsu2|10703
ATGGGCGCCTACATCGACCACTCGAAGACGACCAAGTCCAAGGACTACCGCGGCACCGGGTCGTTTGCGACCTTT
ATGATCATTGGGCGTACGTGGGCCTTCCGCCACTGCTGCTTTCTTTGGCAGGGACCGGACGAATGCTGACTTGCC
AATGCCAGCGACGTGCTTCTTCCTCGGCATCCTCTTCGCCTCCTTCCCCTACGACTTCCCCCTCCTCTGGACCAA
GGACCCGGTCAGCGACGACTACTATGACCAGCTGGAGGCGCACCTCAAGTTCCTGCACCAGTCGCCGCCGCTCAT
CGGCCGGCTGCTCAACATCATCGTCAGCGTCGGCTTCCTCGGCCTCTTCATCAAGCTCTTCCGGCCCAGCGAGGC
CAACTTCCTGTTCGACGGCGCGTCGCTGATCCTCTACACCATCGGCGTCGCCGTCTACATCTCCAACATCGTCAA
GGGCCTGCGCACCCTCAGCTCCGGCCTCTGGGACAGCGACGAGTTCCGGCACAACCGCGAGGGGCGCTTCGAGGG
CGAGTTCATCCTCGGCCGCGAGGACAGCCTCAAGGTGCTGGCCGCCAGCAACACCATCCTGGCACTCGTCCTCAT
CGGCGTCCTCGTCCTCCAGGCCGGCCAGTGGTACGCGGAGAAGAGGGACTCGGACGACGAGGCCGCCGCCGCCGC
CGAGAAGACGGAGCCGTCGCCCAACAGCAAGGCGGCCGCCAAGAAGAAGCAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail