Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10702
Gene name
LocationContig_892:7417..7991
Strand-
Gene length (bp)574
Transcript length (bp)501
Coding sequence length (bp)501
Protein length (aa) 167

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 4.0E-16 43 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 43 141 7.0E-12
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 36 155 7.0E-10
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 41 141 9.0E-10
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 40 156 6.0E-09
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 37 144 9.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 43 141 7.0E-12
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 36 155 7.0E-10
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 41 141 9.0E-10
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 40 156 6.0E-09
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 37 144 9.0E-09
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 43 142 1.0E-08
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 43 155 2.0E-08
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 45 153 7.0E-07
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 41 140 2.0E-06
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 25 140 2.0E-06
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 43 140 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 7 24 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10702
MAPSPRLLLPLALLLLLLLSSALVDAQQPPAVRIYNESRRYAYHGCYNETTEVEGSARARALADGFNDVRQGDMT
VPLCLGLCGNAATPYRYAGLEWSRECWCSQTLAGIARRLDDAQCRFPCEGDRTTACGGSLKLSVYRLTAGSARLG
ASALVASLGLALAFLS*
Coding >Hirsu2|10702
ATGGCTCCCTCACCGAGGCTCCTGCTGCCCCTGGCCCTGCTGCTCCTCCTCCTCCTCTCCTCGGCGCTCGTCGAC
GCGCAGCAGCCGCCGGCCGTGCGCATCTACAACGAGTCCCGCCGCTACGCCTACCACGGCTGCTACAACGAGACG
ACCGAGGTCGAGGGCTCCGCCCGCGCCCGCGCCCTGGCCGACGGCTTCAACGACGTCCGCCAGGGCGACATGACG
GTGCCCCTGTGCCTGGGCCTGTGCGGCAACGCCGCCACGCCCTACCGCTACGCCGGCCTGGAATGGTCGCGAGAG
TGCTGGTGCTCGCAGACGCTGGCCGGCATCGCCCGCAGGCTCGACGACGCCCAGTGCCGCTTCCCCTGCGAGGGC
GACCGCACGACGGCCTGTGGCGGCTCCCTGAAGCTGTCCGTCTATCGCCTGACTGCCGGCTCCGCCCGGCTAGGC
GCTTCGGCCCTCGTCGCCTCGCTCGGCCTCGCTCTGGCGTTCCTGTCCTGA
Transcript >Hirsu2|10702
ATGGCTCCCTCACCGAGGCTCCTGCTGCCCCTGGCCCTGCTGCTCCTCCTCCTCCTCTCCTCGGCGCTCGTCGAC
GCGCAGCAGCCGCCGGCCGTGCGCATCTACAACGAGTCCCGCCGCTACGCCTACCACGGCTGCTACAACGAGACG
ACCGAGGTCGAGGGCTCCGCCCGCGCCCGCGCCCTGGCCGACGGCTTCAACGACGTCCGCCAGGGCGACATGACG
GTGCCCCTGTGCCTGGGCCTGTGCGGCAACGCCGCCACGCCCTACCGCTACGCCGGCCTGGAATGGTCGCGAGAG
TGCTGGTGCTCGCAGACGCTGGCCGGCATCGCCCGCAGGCTCGACGACGCCCAGTGCCGCTTCCCCTGCGAGGGC
GACCGCACGACGGCCTGTGGCGGCTCCCTGAAGCTGTCCGTCTATCGCCTGACTGCCGGCTCCGCCCGGCTAGGC
GCTTCGGCCCTCGTCGCCTCGCTCGGCCTCGCTCTGGCGTTCCTGTCCTGA
Gene >Hirsu2|10702
ATGGCTCCCTCACCGAGGCTCCTGCTGCCCCTGGCCCTGCTGCTCCTCCTCCTCCTCTCCTCGGCGCTCGTCGAC
GCGCAGCAGCCGCCGGCCGTGCGCATCTACAACGAGTCCCGCCGCTACGCCTACCACGGCTGCTACAACGAGACG
ACCGAGGTCGAGGGCTCCGCCCGCGCCCGCGCCCTGGCCGACGGCTTCAACGACGTCCGCCAGGGCGACATGACG
GTGCCCCTGTGCCTGGGCCTGTGCGGCAACGCCGCCACGCCCTACCGCTACGCCGGCCTGGAATGGTCGCGGTAC
GCCTTCTCGCCTCCTGCCCGCTCGACTCCTGCCCGCTTCCCTTCGCCTGCTGACGAGCCACCGGAGCAGAGAGTG
CTGGTGCTCGCAGACGCTGGCCGGCATCGCCCGCAGGCTCGACGACGCCCAGTGCCGCTTCCCCTGCGAGGGCGA
CCGCACGACGGCCTGTGGCGGCTCCCTGAAGCTGTCCGTCTATCGCCTGACTGCCGGCTCCGCCCGGCTAGGCGC
TTCGGCCCTCGTCGCCTCGCTCGGCCTCGCTCTGGCGTTCCTGTCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail