Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10702
Gene name
LocationContig_892:7417..7991
Strand-
Gene length (bp)574
Transcript length (bp)501
Coding sequence length (bp)501
Protein length (aa) 167

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 4.2E-16 43 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 43 141 7.0E-12
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 36 155 7.0E-10
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 41 141 9.0E-10
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 40 156 6.0E-09
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 37 144 9.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 43 141 7.0E-12
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 36 155 7.0E-10
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 41 141 9.0E-10
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 40 156 6.0E-09
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 37 144 9.0E-09
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 43 142 1.0E-08
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 43 155 2.0E-08
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 45 153 7.0E-07
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 41 140 2.0E-06
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 25 140 2.0E-06
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 43 140 4.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular|Cell membrane 0.1474 0.0433 0.6869 0.5938 0.1032 0.0912 0.3728 0.3322 0.3507 0.0065

SignalP

SignalP signal predicted Location Score
Yes 1 - 26 0.999768

Transmembrane Domains

Domain # Start End Length
1 7 24 17

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4826
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3481
Ophiocordyceps australis map64 (Brazil) OphauB2|3393
Ophiocordyceps australis map64 (Brazil) OphauB2|510
Ophiocordyceps australis map64 (Brazil) OphauB2|6706
Ophiocordyceps subramaniannii Hirsu2|10702 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10702
MAPSPRLLLPLALLLLLLLSSALVDAQQPPAVRIYNESRRYAYHGCYNETTEVEGSARARALADGFNDVRQGDMT
VPLCLGLCGNAATPYRYAGLEWSRECWCSQTLAGIARRLDDAQCRFPCEGDRTTACGGSLKLSVYRLTAGSARLG
ASALVASLGLALAFLS*
Coding >Hirsu2|10702
ATGGCTCCCTCACCGAGGCTCCTGCTGCCCCTGGCCCTGCTGCTCCTCCTCCTCCTCTCCTCGGCGCTCGTCGAC
GCGCAGCAGCCGCCGGCCGTGCGCATCTACAACGAGTCCCGCCGCTACGCCTACCACGGCTGCTACAACGAGACG
ACCGAGGTCGAGGGCTCCGCCCGCGCCCGCGCCCTGGCCGACGGCTTCAACGACGTCCGCCAGGGCGACATGACG
GTGCCCCTGTGCCTGGGCCTGTGCGGCAACGCCGCCACGCCCTACCGCTACGCCGGCCTGGAATGGTCGCGAGAG
TGCTGGTGCTCGCAGACGCTGGCCGGCATCGCCCGCAGGCTCGACGACGCCCAGTGCCGCTTCCCCTGCGAGGGC
GACCGCACGACGGCCTGTGGCGGCTCCCTGAAGCTGTCCGTCTATCGCCTGACTGCCGGCTCCGCCCGGCTAGGC
GCTTCGGCCCTCGTCGCCTCGCTCGGCCTCGCTCTGGCGTTCCTGTCCTGA
Transcript >Hirsu2|10702
ATGGCTCCCTCACCGAGGCTCCTGCTGCCCCTGGCCCTGCTGCTCCTCCTCCTCCTCTCCTCGGCGCTCGTCGAC
GCGCAGCAGCCGCCGGCCGTGCGCATCTACAACGAGTCCCGCCGCTACGCCTACCACGGCTGCTACAACGAGACG
ACCGAGGTCGAGGGCTCCGCCCGCGCCCGCGCCCTGGCCGACGGCTTCAACGACGTCCGCCAGGGCGACATGACG
GTGCCCCTGTGCCTGGGCCTGTGCGGCAACGCCGCCACGCCCTACCGCTACGCCGGCCTGGAATGGTCGCGAGAG
TGCTGGTGCTCGCAGACGCTGGCCGGCATCGCCCGCAGGCTCGACGACGCCCAGTGCCGCTTCCCCTGCGAGGGC
GACCGCACGACGGCCTGTGGCGGCTCCCTGAAGCTGTCCGTCTATCGCCTGACTGCCGGCTCCGCCCGGCTAGGC
GCTTCGGCCCTCGTCGCCTCGCTCGGCCTCGCTCTGGCGTTCCTGTCCTGA
Gene >Hirsu2|10702
ATGGCTCCCTCACCGAGGCTCCTGCTGCCCCTGGCCCTGCTGCTCCTCCTCCTCCTCTCCTCGGCGCTCGTCGAC
GCGCAGCAGCCGCCGGCCGTGCGCATCTACAACGAGTCCCGCCGCTACGCCTACCACGGCTGCTACAACGAGACG
ACCGAGGTCGAGGGCTCCGCCCGCGCCCGCGCCCTGGCCGACGGCTTCAACGACGTCCGCCAGGGCGACATGACG
GTGCCCCTGTGCCTGGGCCTGTGCGGCAACGCCGCCACGCCCTACCGCTACGCCGGCCTGGAATGGTCGCGGTAC
GCCTTCTCGCCTCCTGCCCGCTCGACTCCTGCCCGCTTCCCTTCGCCTGCTGACGAGCCACCGGAGCAGAGAGTG
CTGGTGCTCGCAGACGCTGGCCGGCATCGCCCGCAGGCTCGACGACGCCCAGTGCCGCTTCCCCTGCGAGGGCGA
CCGCACGACGGCCTGTGGCGGCTCCCTGAAGCTGTCCGTCTATCGCCTGACTGCCGGCTCCGCCCGGCTAGGCGC
TTCGGCCCTCGTCGCCTCGCTCGGCCTCGCTCTGGCGTTCCTGTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail