Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10701
Gene name
LocationContig_892:3727..7226
Strand+
Gene length (bp)3499
Transcript length (bp)3447
Coding sequence length (bp)3447
Protein length (aa) 1149

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00817 IMS impB/mucB/samB family 5.4E-38 370 533
PF16727 REV1_C DNA repair protein REV1 C-terminal domain 2.2E-26 1057 1146
PF11799 IMS_C impB/mucB/samB family C-terminal domain 8.8E-14 617 742
PF14377 UBM Ubiquitin binding region 1.5E-04 882 907
PF14377 UBM Ubiquitin binding region 1.8E-06 979 1007
PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain 1.1E-07 62 147
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 2.1E-04 61 135

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94623|REV1_SCHPO DNA repair protein rev1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev1 PE=3 SV=3 273 856 3.0E-96
sp|A3EWL3|REV1_ARATH DNA repair protein REV1 OS=Arabidopsis thaliana GN=REV1 PE=2 SV=1 37 1042 5.0E-96
sp|Q920Q2|REV1_MOUSE DNA repair protein REV1 OS=Mus musculus GN=Rev1 PE=1 SV=1 311 1140 7.0E-89
sp|Q9UBZ9|REV1_HUMAN DNA repair protein REV1 OS=Homo sapiens GN=REV1 PE=1 SV=1 311 912 1.0E-86
sp|Q5R4N7|REV1_PONAB DNA repair protein REV1 OS=Pongo abelii GN=REV1 PE=2 SV=1 311 912 1.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94623|REV1_SCHPO DNA repair protein rev1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev1 PE=3 SV=3 273 856 3.0E-96
sp|A3EWL3|REV1_ARATH DNA repair protein REV1 OS=Arabidopsis thaliana GN=REV1 PE=2 SV=1 37 1042 5.0E-96
sp|Q920Q2|REV1_MOUSE DNA repair protein REV1 OS=Mus musculus GN=Rev1 PE=1 SV=1 311 1140 7.0E-89
sp|Q9UBZ9|REV1_HUMAN DNA repair protein REV1 OS=Homo sapiens GN=REV1 PE=1 SV=1 311 912 1.0E-86
sp|Q5R4N7|REV1_PONAB DNA repair protein REV1 OS=Pongo abelii GN=REV1 PE=2 SV=1 311 912 1.0E-85
sp|Q4KWZ7|REV1_CHICK DNA repair protein REV1 OS=Gallus gallus GN=REV1 PE=2 SV=1 402 918 5.0E-82
sp|P12689|REV1_YEAST DNA repair protein REV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV1 PE=1 SV=2 309 856 1.0E-63
sp|Q9CNG4|DPO4_PASMU DNA polymerase IV OS=Pasteurella multocida (strain Pm70) GN=dinB PE=3 SV=1 367 627 2.0E-34
sp|A1JNY3|DPO4_YERE8 DNA polymerase IV OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dinB PE=3 SV=1 367 655 3.0E-34
sp|P63989|DPO4_SALTY DNA polymerase IV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dinB PE=3 SV=1 367 655 1.0E-33
sp|P63990|DPO4_SALTI DNA polymerase IV OS=Salmonella typhi GN=dinB PE=3 SV=1 367 655 1.0E-33
sp|A9MY13|DPO4_SALPB DNA polymerase IV OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dinB PE=3 SV=1 367 655 1.0E-33
sp|Q5PF76|DPO4_SALPA DNA polymerase IV OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dinB PE=3 SV=1 367 655 2.0E-33
sp|Q57SU1|DPO4_SALCH DNA polymerase IV OS=Salmonella choleraesuis (strain SC-B67) GN=dinB PE=3 SV=1 367 655 3.0E-33
sp|Q12Q05|DPO4_SHEDO DNA polymerase IV OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dinB PE=3 SV=1 367 654 4.0E-33
sp|Q6FFG4|DPO4_ACIAD DNA polymerase IV OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dinB PE=3 SV=1 367 738 1.0E-32
sp|A4W6W8|DPO4_ENT38 DNA polymerase IV OS=Enterobacter sp. (strain 638) GN=dinB PE=3 SV=1 367 655 2.0E-32
sp|A7MEN4|DPO4_CROS8 DNA polymerase IV OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dinB PE=3 SV=1 367 659 4.0E-32
sp|Q83M86|DPO4_SHIFL DNA polymerase IV OS=Shigella flexneri GN=dinB PE=3 SV=1 367 655 4.0E-32
sp|A9MNS1|DPO4_SALAR DNA polymerase IV OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dinB PE=3 SV=1 367 655 4.0E-32
sp|A3QGY9|DPO4_SHELP DNA polymerase IV OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dinB PE=3 SV=1 367 655 6.0E-32
sp|Q87MB4|DPO4_VIBPA DNA polymerase IV OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dinB PE=3 SV=1 367 655 7.0E-32
sp|Q1I6D5|DPO4_PSEE4 DNA polymerase IV OS=Pseudomonas entomophila (strain L48) GN=dinB PE=3 SV=1 367 630 7.0E-32
sp|Q086K1|DPO4_SHEFN DNA polymerase IV OS=Shewanella frigidimarina (strain NCIMB 400) GN=dinB PE=3 SV=1 367 655 9.0E-32
sp|A7ZHZ2|DPO4_ECO24 DNA polymerase IV OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dinB PE=3 SV=1 367 655 1.0E-31
sp|Q1RFU0|DPO4_ECOUT DNA polymerase IV OS=Escherichia coli (strain UTI89 / UPEC) GN=dinB PE=3 SV=1 367 655 1.0E-31
sp|Q0TL85|DPO4_ECOL5 DNA polymerase IV OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dinB PE=3 SV=1 367 655 1.0E-31
sp|A1A7U2|DPO4_ECOK1 DNA polymerase IV OS=Escherichia coli O1:K1 / APEC GN=dinB PE=3 SV=1 367 655 1.0E-31
sp|Q3Z5A4|DPO4_SHISS DNA polymerase IV OS=Shigella sonnei (strain Ss046) GN=dinB PE=3 SV=1 367 655 1.0E-31
sp|Q47155|DPO4_ECOLI DNA polymerase IV OS=Escherichia coli (strain K12) GN=dinB PE=1 SV=1 367 655 1.0E-31
sp|B1J100|DPO4_ECOLC DNA polymerase IV OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dinB PE=3 SV=1 367 655 1.0E-31
sp|B0BPX9|DPO4_ACTPJ DNA polymerase IV OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dinB PE=3 SV=1 367 655 1.0E-31
sp|Q32J17|DPO4_SHIDS DNA polymerase IV OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dinB PE=3 SV=1 367 655 1.0E-31
sp|Q6D1H8|DPO4_PECAS DNA polymerase IV OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dinB PE=3 SV=1 367 655 2.0E-31
sp|A8AKQ2|DPO4_CITK8 DNA polymerase IV OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=dinB PE=3 SV=1 367 655 2.0E-31
sp|A7ZWJ6|DPO4_ECOHS DNA polymerase IV OS=Escherichia coli O9:H4 (strain HS) GN=dinB PE=3 SV=1 367 655 2.0E-31
sp|B2U3S3|DPO4_SHIB3 DNA polymerase IV OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dinB PE=3 SV=1 367 655 2.0E-31
sp|Q8XZ19|DPO4_RALSO DNA polymerase IV OS=Ralstonia solanacearum (strain GMI1000) GN=dinB PE=3 SV=2 367 669 2.0E-31
sp|B0TZS5|DPO4_FRAP2 DNA polymerase IV OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=dinB PE=3 SV=1 367 661 3.0E-31
sp|P59477|DPO4_ECOL6 DNA polymerase IV OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dinB PE=3 SV=1 367 655 3.0E-31
sp|Q8X7Q1|DPO4_ECO57 DNA polymerase IV OS=Escherichia coli O157:H7 GN=dinB PE=3 SV=1 367 655 3.0E-31
sp|A4XT24|DPO4_PSEMY DNA polymerase IV OS=Pseudomonas mendocina (strain ymp) GN=dinB PE=3 SV=1 367 655 3.0E-31
sp|Q88NK4|DPO4_PSEPK DNA polymerase IV OS=Pseudomonas putida (strain KT2440) GN=dinB PE=3 SV=1 367 630 4.0E-31
sp|A0KTR5|DPO4_SHESA DNA polymerase IV OS=Shewanella sp. (strain ANA-3) GN=dinB PE=3 SV=1 367 671 4.0E-31
sp|A8FYV3|DPO4_SHESH DNA polymerase IV OS=Shewanella sediminis (strain HAW-EB3) GN=dinB PE=3 SV=1 367 655 5.0E-31
sp|Q87Y22|DPO4_PSESM DNA polymerase IV OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dinB PE=3 SV=1 367 630 6.0E-31
sp|A5VZT3|DPO4_PSEP1 DNA polymerase IV OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dinB PE=3 SV=1 367 630 6.0E-31
sp|A3N148|DPO4_ACTP2 DNA polymerase IV OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dinB PE=3 SV=1 367 655 6.0E-31
sp|B0KTK6|DPO4_PSEPG DNA polymerase IV OS=Pseudomonas putida (strain GB-1) GN=dinB PE=3 SV=1 367 630 6.0E-31
sp|Q2A3L2|DPO4_FRATH DNA polymerase IV OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dinB PE=3 SV=1 356 627 7.0E-31
sp|A7NC07|DPO4_FRATF DNA polymerase IV OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=dinB PE=3 SV=1 356 627 7.0E-31
sp|B2SH34|DPO4_FRATM DNA polymerase IV OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=dinB PE=3 SV=1 356 627 8.0E-31
sp|Q48FB2|DPO4_PSE14 DNA polymerase IV OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dinB PE=3 SV=1 367 630 1.0E-30
sp|Q71Y46|DPO4_LISMF DNA polymerase IV OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dinB PE=3 SV=1 367 748 1.0E-30
sp|Q92A40|DPO4_LISIN DNA polymerase IV OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dinB PE=3 SV=1 367 748 1.0E-30
sp|A8GAC8|DPO4_SERP5 DNA polymerase IV OS=Serratia proteamaculans (strain 568) GN=dinB PE=3 SV=1 367 655 1.0E-30
sp|A0AK80|DPO4_LISW6 DNA polymerase IV OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dinB PE=3 SV=1 367 748 1.0E-30
sp|A0Q6K9|DPO4_FRATN DNA polymerase IV OS=Francisella tularensis subsp. novicida (strain U112) GN=dinB PE=3 SV=1 356 627 1.0E-30
sp|C1KWR9|DPO4_LISMC DNA polymerase IV OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dinB PE=3 SV=1 367 748 2.0E-30
sp|A9L0T3|DPO4_SHEB9 DNA polymerase IV OS=Shewanella baltica (strain OS195) GN=dinB PE=3 SV=1 367 655 2.0E-30
sp|Q4ZWM4|DPO4_PSEU2 DNA polymerase IV OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dinB PE=3 SV=1 367 630 2.0E-30
sp|Q65TG8|DPO4_MANSM DNA polymerase IV OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dinB PE=3 SV=1 356 685 3.0E-30
sp|Q0BM23|DPO4_FRATO DNA polymerase IV OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=dinB PE=3 SV=1 356 627 3.0E-30
sp|A0KHD5|DPO4_AERHH DNA polymerase IV OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dinB PE=3 SV=1 367 669 3.0E-30
sp|Q0HY21|DPO4_SHESR DNA polymerase IV OS=Shewanella sp. (strain MR-7) GN=dinB PE=3 SV=1 367 671 3.0E-30
sp|A3D147|DPO4_SHEB5 DNA polymerase IV OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dinB PE=3 SV=1 367 655 3.0E-30
sp|A6WRW5|DPO4_SHEB8 DNA polymerase IV OS=Shewanella baltica (strain OS185) GN=dinB PE=3 SV=1 367 655 4.0E-30
sp|P58965|DPO4_CALS4 DNA polymerase IV OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dinB PE=3 SV=1 367 740 4.0E-30
sp|Q0HLP0|DPO4_SHESM DNA polymerase IV OS=Shewanella sp. (strain MR-4) GN=dinB PE=3 SV=1 367 669 7.0E-30
sp|B0TQD1|DPO4_SHEHH DNA polymerase IV OS=Shewanella halifaxensis (strain HAW-EB4) GN=dinB PE=3 SV=1 367 655 1.0E-29
sp|A1S8M3|DPO4_SHEAM DNA polymerase IV OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dinB PE=3 SV=1 367 655 1.0E-29
sp|B1KD33|DPO4_SHEWM DNA polymerase IV OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dinB PE=3 SV=1 367 655 1.0E-29
sp|Q9A5I1|DPO4_CAUCR DNA polymerase IV OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dinB PE=3 SV=2 367 684 2.0E-29
sp|Q64X95|DPO4_BACFR DNA polymerase IV OS=Bacteroides fragilis (strain YCH46) GN=dinB PE=3 SV=1 367 669 2.0E-29
sp|Q8PT42|DPO42_METMA DNA polymerase IV 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dbh2 PE=3 SV=1 358 625 2.0E-29
sp|Q8Y5T0|DPO4_LISMO DNA polymerase IV OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dinB PE=3 SV=1 367 748 2.0E-29
sp|B8DBV7|DPO4_LISMH DNA polymerase IV OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dinB PE=3 SV=1 367 748 3.0E-29
sp|B8F542|DPO4_HAEPS DNA polymerase IV OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dinB PE=3 SV=1 367 705 3.0E-29
sp|Q487H6|DPO4_COLP3 DNA polymerase IV OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dinB PE=3 SV=1 362 655 3.0E-29
sp|A3CSG3|DPO4_METMJ DNA polymerase IV OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=dbh PE=3 SV=1 367 737 4.0E-29
sp|A1KUQ3|DPO4_NEIMF DNA polymerase IV OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dinB PE=3 SV=1 367 669 6.0E-29
sp|Q3KH18|DPO4_PSEPF DNA polymerase IV OS=Pseudomonas fluorescens (strain Pf0-1) GN=dinB PE=3 SV=1 367 655 7.0E-29
sp|Q8EHU9|DPO4_SHEON DNA polymerase IV OS=Shewanella oneidensis (strain MR-1) GN=dinB PE=3 SV=1 367 655 8.0E-29
sp|Q5ZY20|DPO4_LEGPH DNA polymerase IV OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dinB PE=3 SV=1 367 630 8.0E-29
sp|Q7N7B6|DPO4_PHOLL DNA polymerase IV OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dinB PE=3 SV=1 367 655 8.0E-29
sp|P58963|DPO4_ESCFE DNA polymerase IV (Fragment) OS=Escherichia fergusonii GN=dinB PE=3 SV=1 375 655 9.0E-29
sp|Q5X7J1|DPO4_LEGPA DNA polymerase IV OS=Legionella pneumophila (strain Paris) GN=dinB PE=3 SV=1 367 630 1.0E-28
sp|Q8PGJ4|DPO4_XANAC DNA polymerase IV OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dinB PE=3 SV=1 367 627 1.0E-28
sp|Q3BP42|DPO4_XANC5 DNA polymerase IV OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dinB PE=3 SV=1 367 627 1.0E-28
sp|A5IH02|DPO4_LEGPC DNA polymerase IV OS=Legionella pneumophila (strain Corby) GN=dinB PE=3 SV=1 367 630 1.0E-28
sp|B8FBE8|DPO4_DESAA DNA polymerase IV OS=Desulfatibacillum alkenivorans (strain AK-01) GN=dinB PE=3 SV=1 367 669 1.0E-28
sp|Q5WYY8|DPO4_LEGPL DNA polymerase IV OS=Legionella pneumophila (strain Lens) GN=dinB PE=3 SV=1 367 630 1.0E-28
sp|Q9JYS8|DPO4_NEIMB DNA polymerase IV OS=Neisseria meningitidis serogroup B (strain MC58) GN=dinB PE=3 SV=1 367 669 1.0E-28
sp|A1RMZ5|DPO4_SHESW DNA polymerase IV OS=Shewanella sp. (strain W3-18-1) GN=dinB PE=3 SV=1 367 655 2.0E-28
sp|Q8PCW8|DPO4_XANCP DNA polymerase IV OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dinB PE=3 SV=1 367 627 3.0E-28
sp|Q4UQI2|DPO4_XANC8 DNA polymerase IV OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dinB PE=3 SV=1 367 627 3.0E-28
sp|Q6MA55|DPO4_PARUW DNA polymerase IV OS=Protochlamydia amoebophila (strain UWE25) GN=dinB PE=3 SV=1 367 656 4.0E-28
sp|B4SIF5|DPO4_STRM5 DNA polymerase IV OS=Stenotrophomonas maltophilia (strain R551-3) GN=dinB PE=3 SV=1 367 627 6.0E-28
sp|B2FLR2|DPO4_STRMK DNA polymerase IV OS=Stenotrophomonas maltophilia (strain K279a) GN=dinB PE=3 SV=1 367 644 6.0E-28
sp|Q5F8N2|DPO4_NEIG1 DNA polymerase IV OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dinB PE=3 SV=1 367 669 1.0E-27
sp|A5F5Y1|DPO4_VIBC3 DNA polymerase IV OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dinB PE=3 SV=1 367 655 1.0E-27
sp|Q9JRG1|DPO4_NEIMA DNA polymerase IV OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dinB PE=3 SV=1 367 669 1.0E-27
sp|A1U339|DPO4_MARHV DNA polymerase IV OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dinB PE=3 SV=1 367 669 1.0E-27
sp|A4TPK8|DPO4_YERPP DNA polymerase IV OS=Yersinia pestis (strain Pestoides F) GN=dinB PE=3 SV=1 367 627 1.0E-27
sp|Q1CLD4|DPO4_YERPN DNA polymerase IV OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dinB PE=3 SV=1 367 627 1.0E-27
sp|Q8ZBZ9|DPO4_YERPE DNA polymerase IV OS=Yersinia pestis GN=dinB PE=3 SV=1 367 627 1.0E-27
sp|Q1C4D9|DPO4_YERPA DNA polymerase IV OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dinB PE=3 SV=1 367 627 1.0E-27
sp|C3LQ59|DPO4_VIBCM DNA polymerase IV OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dinB PE=3 SV=1 367 655 1.0E-27
sp|Q9KPS5|DPO4_VIBCH DNA polymerase IV OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dinB PE=3 SV=1 367 655 1.0E-27
sp|A8H771|DPO4_SHEPA DNA polymerase IV OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dinB PE=3 SV=1 367 655 2.0E-27
sp|Q15YP8|DPO4_PSEA6 DNA polymerase IV OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dinB PE=3 SV=1 367 655 3.0E-27
sp|Q9I534|DPO4_PSEAE DNA polymerase IV OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dinB PE=3 SV=1 367 630 3.0E-27
sp|Q02I83|DPO4_PSEAB DNA polymerase IV OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dinB PE=3 SV=1 367 630 3.0E-27
sp|Q2P7M9|DPO4_XANOM DNA polymerase IV OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dinB PE=3 SV=1 367 627 3.0E-27
sp|A6W1V6|DPO4_MARMS DNA polymerase IV OS=Marinomonas sp. (strain MWYL1) GN=dinB PE=3 SV=1 367 669 3.0E-27
sp|Q66DZ7|DPO4_YERPS DNA polymerase IV OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dinB PE=3 SV=1 367 627 4.0E-27
sp|A7FLI9|DPO4_YERP3 DNA polymerase IV OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dinB PE=3 SV=1 367 627 4.0E-27
sp|Q7MID6|DPO4_VIBVY DNA polymerase IV OS=Vibrio vulnificus (strain YJ016) GN=dinB PE=3 SV=2 367 686 4.0E-27
sp|Q8DBI7|DPO4_VIBVU DNA polymerase IV OS=Vibrio vulnificus (strain CMCP6) GN=dinB PE=3 SV=2 367 686 4.0E-27
sp|A6VA50|DPO4_PSEA7 DNA polymerase IV OS=Pseudomonas aeruginosa (strain PA7) GN=dinB PE=3 SV=1 367 630 6.0E-27
sp|Q88V07|DPO4_LACPL DNA polymerase IV OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dinB PE=3 SV=2 367 739 1.0E-26
sp|A1WY69|DPO4_HALHL DNA polymerase IV OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dinB PE=3 SV=1 367 669 1.0E-26
sp|B2UKN1|DPO4_AKKM8 DNA polymerase IV OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=dinB PE=3 SV=1 367 669 2.0E-26
sp|P58964|DPO4_STAAW DNA polymerase IV OS=Staphylococcus aureus (strain MW2) GN=dinB PE=3 SV=1 367 669 2.0E-26
sp|Q6G838|DPO4_STAAS DNA polymerase IV OS=Staphylococcus aureus (strain MSSA476) GN=dinB PE=3 SV=1 367 669 2.0E-26
sp|A6QIC3|DPO4_STAAE DNA polymerase IV OS=Staphylococcus aureus (strain Newman) GN=dinB PE=3 SV=1 367 669 2.0E-26
sp|Q5HEM7|DPO4_STAAC DNA polymerase IV OS=Staphylococcus aureus (strain COL) GN=dinB PE=3 SV=1 367 669 2.0E-26
sp|Q9AK82|DPO4_STRCO DNA polymerase IV OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dinB PE=3 SV=2 367 671 2.0E-26
sp|Q73P36|DPO4_TREDE DNA polymerase IV OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dinB PE=3 SV=1 367 669 2.0E-26
sp|A5IU61|DPO4_STAA9 DNA polymerase IV OS=Staphylococcus aureus (strain JH9) GN=dinB PE=3 SV=1 367 669 3.0E-26
sp|A6U2Z9|DPO4_STAA2 DNA polymerase IV OS=Staphylococcus aureus (strain JH1) GN=dinB PE=3 SV=1 367 669 3.0E-26
sp|Q2YU32|DPO4_STAAB DNA polymerase IV OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dinB PE=3 SV=1 367 669 3.0E-26
sp|P63992|DPO4_STAAN DNA polymerase IV OS=Staphylococcus aureus (strain N315) GN=dinB PE=3 SV=1 367 669 3.0E-26
sp|P63991|DPO4_STAAM DNA polymerase IV OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dinB PE=3 SV=1 367 669 3.0E-26
sp|A7X420|DPO4_STAA1 DNA polymerase IV OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dinB PE=3 SV=1 367 669 3.0E-26
sp|Q6GFG2|DPO4_STAAR DNA polymerase IV OS=Staphylococcus aureus (strain MRSA252) GN=dinB PE=3 SV=1 367 669 5.0E-26
sp|Q72MY7|DPO4_LEPIC DNA polymerase IV OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dinB PE=3 SV=2 367 669 6.0E-26
sp|P9WNT1|DPO42_MYCTU DNA polymerase IV 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dinB2 PE=3 SV=1 366 669 8.0E-26
sp|P9WNT0|DPO42_MYCTO DNA polymerase IV 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dinB2 PE=3 SV=1 366 669 8.0E-26
sp|P63988|DPO42_MYCBO DNA polymerase IV 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dinB2 PE=3 SV=1 366 669 8.0E-26
sp|A4VZ21|DPO4_STRS2 DNA polymerase IV OS=Streptococcus suis (strain 98HAH33) GN=dinB PE=3 SV=1 367 737 8.0E-26
sp|Q8F8Q2|DPO4_LEPIN DNA polymerase IV OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dinB PE=3 SV=2 367 669 1.0E-25
sp|B9DMT3|DPO4_STACT DNA polymerase IV OS=Staphylococcus carnosus (strain TM300) GN=dinB PE=3 SV=1 362 669 1.0E-25
sp|Q4L7K8|DPO4_STAHJ DNA polymerase IV OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dinB PE=3 SV=1 367 669 2.0E-25
sp|Q02WA3|DPO4_LACLS DNA polymerase IV OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=dinB PE=3 SV=1 367 682 3.0E-25
sp|A8AUV7|DPO4_STRGC DNA polymerase IV OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=dinB PE=3 SV=1 367 737 3.0E-25
sp|A2RNH9|DPO4_LACLM DNA polymerase IV OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=dinB PE=3 SV=1 367 682 3.0E-25
sp|Q974T8|DPO4_SULTO DNA polymerase IV OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=dbh PE=3 SV=2 367 596 4.0E-25
sp|Q8UJK7|DPO42_AGRFC DNA polymerase IV 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dinB2 PE=3 SV=2 367 669 4.0E-25
sp|O94623|REV1_SCHPO DNA repair protein rev1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev1 PE=3 SV=3 21 164 5.0E-25
sp|Q9UNA4|POLI_HUMAN DNA polymerase iota OS=Homo sapiens GN=POLI PE=1 SV=3 367 672 7.0E-25
sp|B1YK83|DPO4_EXIS2 DNA polymerase IV OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dinB PE=3 SV=1 367 630 8.0E-25
sp|Q5LYC2|DPO4_STRT1 DNA polymerase IV OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dinB PE=3 SV=1 367 737 2.0E-24
sp|Q49YT9|DPO4_STAS1 DNA polymerase IV OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dinB PE=3 SV=1 367 669 2.0E-24
sp|A3CKU4|DPO4_STRSV DNA polymerase IV OS=Streptococcus sanguinis (strain SK36) GN=dinB PE=3 SV=1 367 737 3.0E-24
sp|Q6AL48|DPO4_DESPS DNA polymerase IV OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=dinB PE=3 SV=1 367 669 6.0E-24
sp|Q3II35|DPO4_PSEHT DNA polymerase IV OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dinB PE=3 SV=1 367 669 8.0E-24
sp|Q3ABL2|DPO4_CARHZ DNA polymerase IV OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dinB PE=3 SV=1 367 629 2.0E-23
sp|P12689|REV1_YEAST DNA repair protein REV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV1 PE=1 SV=2 56 167 3.0E-23
sp|Q8PYH6|DPO41_METMA DNA polymerase IV 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dbh1 PE=3 SV=1 367 618 3.0E-23
sp|Q5M2Y5|DPO4_STRT2 DNA polymerase IV OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dinB PE=3 SV=1 367 737 3.0E-23
sp|Q9PQ53|DPO4_UREPA DNA polymerase IV OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=dinB PE=3 SV=2 367 625 3.0E-23
sp|B1AJ79|DPO4_UREP2 DNA polymerase IV OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=dinB PE=3 SV=1 367 625 3.0E-23
sp|Q5XA48|DPO4_STRP6 DNA polymerase IV OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dinB PE=3 SV=1 367 737 3.0E-23
sp|Q99Y66|DPO4_STRP1 DNA polymerase IV OS=Streptococcus pyogenes serotype M1 GN=dinB PE=3 SV=2 367 737 5.0E-23
sp|Q1JF59|DPO4_STRPD DNA polymerase IV OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dinB PE=3 SV=1 367 737 5.0E-23
sp|Q6R3M4|POLI_MOUSE DNA polymerase iota OS=Mus musculus GN=Poli PE=1 SV=1 367 675 5.0E-23
sp|Q48RJ4|DPO4_STRPM DNA polymerase IV OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dinB PE=3 SV=1 367 737 5.0E-23
sp|A2RCQ1|DPO4_STRPG DNA polymerase IV OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dinB PE=3 SV=1 367 737 6.0E-23
sp|A5N2U5|DPO4_CLOK5 DNA polymerase IV OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dinB PE=3 SV=1 367 615 6.0E-23
sp|Q8NZI1|DPO4_STRP8 DNA polymerase IV OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dinB PE=3 SV=1 367 737 7.0E-23
sp|Q03J54|DPO4_STRTD DNA polymerase IV OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=dinB PE=3 SV=1 367 737 7.0E-23
sp|Q8REB0|DPO4_FUSNN DNA polymerase IV OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=dinB PE=3 SV=1 367 731 1.0E-22
sp|Q98NW7|DPO43_RHILO DNA polymerase IV 3 OS=Rhizobium loti (strain MAFF303099) GN=dinB3 PE=3 SV=1 367 669 1.0E-22
sp|Q92XH8|DPO42_RHIME DNA polymerase IV 2 OS=Rhizobium meliloti (strain 1021) GN=dinB2 PE=3 SV=2 367 669 1.0E-22
sp|Q5FSM8|DPO4_GLUOX DNA polymerase IV OS=Gluconobacter oxydans (strain 621H) GN=dinB PE=3 SV=1 367 669 2.0E-22
sp|Q8UFV3|DPO41_AGRFC DNA polymerase IV 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dinB1 PE=3 SV=2 367 669 2.0E-22
sp|B5ZBT4|DPO4_UREU1 DNA polymerase IV OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=dinB PE=3 SV=1 367 625 2.0E-22
sp|Q8CNP3|DPO4_STAES DNA polymerase IV OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dinB PE=3 SV=1 367 669 2.0E-22
sp|Q1J509|DPO4_STRPF DNA polymerase IV OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dinB PE=3 SV=1 367 737 2.0E-22
sp|Q0SSQ2|DPO4_CLOPS DNA polymerase IV OS=Clostridium perfringens (strain SM101 / Type A) GN=dinB PE=3 SV=1 363 669 3.0E-22
sp|P96022|DPO4_SULSF DNA polymerase IV OS=Sulfolobus solfataricus GN=dbh PE=1 SV=1 367 583 3.0E-22
sp|Q4JB80|DPO4_SULAC DNA polymerase IV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=dbh PE=1 SV=1 367 583 3.0E-22
sp|Q5HN39|DPO4_STAEQ DNA polymerase IV OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dinB PE=3 SV=1 367 669 4.0E-22
sp|Q1JK63|DPO4_STRPC DNA polymerase IV OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dinB PE=3 SV=1 367 737 5.0E-22
sp|Q1JA16|DPO4_STRPB DNA polymerase IV OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=dinB PE=3 SV=1 367 737 5.0E-22
sp|Q8XK37|DPO4_CLOPE DNA polymerase IV OS=Clostridium perfringens (strain 13 / Type A) GN=dinB PE=3 SV=1 363 628 5.0E-22
sp|Q18A91|DPO4_PEPD6 DNA polymerase IV OS=Peptoclostridium difficile (strain 630) GN=dinB PE=3 SV=1 367 742 1.0E-21
sp|Q9CE21|DPO4_LACLA DNA polymerase IV OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dinB PE=3 SV=1 367 631 1.0E-21
sp|Q0A4X2|DPO4_ALKEH DNA polymerase IV OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dinB PE=3 SV=1 367 669 1.0E-21
sp|Q0TQ38|DPO4_CLOP1 DNA polymerase IV OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=dinB PE=3 SV=1 363 669 2.0E-21
sp|A9A3A9|DPO4_NITMS DNA polymerase IV OS=Nitrosopumilus maritimus (strain SCM1) GN=dbh PE=3 SV=1 363 620 2.0E-21
sp|Q8TIW3|DPO4_METAC DNA polymerase IV OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dbh PE=3 SV=1 367 618 2.0E-21
sp|Q8DVR7|DPO4_STRMU DNA polymerase IV OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dinB PE=3 SV=1 367 737 3.0E-21
sp|Q6KZW2|DPO4_PICTO DNA polymerase IV OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dbh PE=3 SV=1 367 596 3.0E-21
sp|Q7USY7|DPO4_RHOBA DNA polymerase IV OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=dinB PE=3 SV=1 367 615 3.0E-21
sp|Q9Y253|POLH_HUMAN DNA polymerase eta OS=Homo sapiens GN=POLH PE=1 SV=1 362 786 4.0E-21
sp|A8MGJ5|DPO4_ALKOO DNA polymerase IV OS=Alkaliphilus oremlandii (strain OhILAs) GN=dinB PE=3 SV=1 367 668 5.0E-21
sp|Q6NGD8|DPO4_CORDI DNA polymerase IV OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=dinB PE=3 SV=1 366 754 5.0E-21
sp|A4QFK8|DPO4_CORGB DNA polymerase IV OS=Corynebacterium glutamicum (strain R) GN=dinB PE=3 SV=1 366 753 5.0E-21
sp|P0DA79|DPO4_STRPQ DNA polymerase IV OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dinB PE=3 SV=1 367 737 6.0E-21
sp|P0DA78|DPO4_STRP3 DNA polymerase IV OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dinB PE=3 SV=1 367 737 6.0E-21
sp|A5FSS1|DPO4_DEHMB DNA polymerase IV OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=dinB PE=3 SV=1 367 686 6.0E-21
sp|Q818U9|DPO4_BACCR DNA polymerase IV OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dinB PE=3 SV=1 367 655 7.0E-21
sp|Q8NNP4|DPO4_CORGL DNA polymerase IV OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=dinB PE=3 SV=1 366 753 8.0E-21
sp|A7Z6F3|DPO4_BACMF DNA polymerase IV OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dinB PE=3 SV=1 367 616 1.0E-20
sp|Q8DXW9|DPO4_STRA5 DNA polymerase IV OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dinB PE=3 SV=1 367 737 1.0E-20
sp|Q8E3I8|DPO4_STRA3 DNA polymerase IV OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dinB PE=3 SV=1 367 737 1.0E-20
sp|Q3JZG9|DPO4_STRA1 DNA polymerase IV OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dinB PE=3 SV=1 367 737 1.0E-20
sp|Q9JJN0|POLH_MOUSE DNA polymerase eta OS=Mus musculus GN=Polh PE=1 SV=1 361 630 3.0E-20
sp|Q97SC7|DPO4_STRPN DNA polymerase IV OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dinB PE=3 SV=2 367 669 4.0E-20
sp|Q3ZWB2|DPO4_DEHMC DNA polymerase IV OS=Dehalococcoides mccartyi (strain CBDB1) GN=dinB PE=3 SV=1 367 686 4.0E-20
sp|Q8YC76|DPO4_BRUME DNA polymerase IV OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dinB PE=3 SV=1 353 669 6.0E-20
sp|Q8DQZ7|DPO4_STRR6 DNA polymerase IV OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dinB PE=3 SV=2 367 669 9.0E-20
sp|Q04M21|DPO4_STRP2 DNA polymerase IV OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dinB PE=3 SV=1 367 669 9.0E-20
sp|Q8FW50|DPO4_BRUSU DNA polymerase IV OS=Brucella suis biovar 1 (strain 1330) GN=dinB PE=3 SV=1 353 669 1.0E-19
sp|Q8EQ56|DPO4_OCEIH DNA polymerase IV OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dinB PE=3 SV=1 367 675 1.0E-19
sp|Q6A763|DPO4_PROAC DNA polymerase IV OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=dinB PE=3 SV=1 367 736 3.0E-19
sp|O74944|POLK_SCHPO DNA polymerase kappa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug40 PE=1 SV=3 367 736 6.0E-19
sp|Q9HQT4|DPO4_HALSA DNA polymerase IV OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=dbh PE=3 SV=2 363 630 7.0E-19
sp|B0R4P0|DPO4_HALS3 DNA polymerase IV OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=dbh PE=3 SV=1 363 630 7.0E-19
sp|P34409|POLK_CAEEL DNA polymerase kappa OS=Caenorhabditis elegans GN=polk-1 PE=3 SV=3 370 736 7.0E-19
sp|Q98LV1|DPO41_RHILO DNA polymerase IV 1 OS=Rhizobium loti (strain MAFF303099) GN=dinB1 PE=3 SV=1 364 669 9.0E-19
sp|A3DH61|DPO4_CLOTH DNA polymerase IV OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dinB PE=3 SV=1 367 736 9.0E-19
sp|Q98JM5|DPO42_RHILO DNA polymerase IV 2 OS=Rhizobium loti (strain MAFF303099) GN=dinB2 PE=3 SV=1 367 669 1.0E-18
sp|Q92QM8|DPO41_RHIME DNA polymerase IV 1 OS=Rhizobium meliloti (strain 1021) GN=dinB1 PE=3 SV=1 353 669 1.0E-18
sp|Q81M86|DPO4_BACAN DNA polymerase IV OS=Bacillus anthracis GN=dinB PE=3 SV=1 367 655 2.0E-18
sp|P54545|DPO41_BACSU DNA polymerase IV 1 OS=Bacillus subtilis (strain 168) GN=dinB1 PE=3 SV=2 361 615 2.0E-18
sp|Q635E0|DPO4_BACCZ DNA polymerase IV OS=Bacillus cereus (strain ZK / E33L) GN=dinB PE=3 SV=1 367 655 5.0E-18
sp|Q67QM6|DPO4_SYMTH DNA polymerase IV OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dinB PE=3 SV=1 366 669 8.0E-18
sp|B1ZN03|DPO4_OPITP DNA polymerase IV OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=dinB PE=3 SV=1 367 669 3.0E-17
sp|Q97W02|DPO4_SULSO DNA polymerase IV OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dbh PE=1 SV=1 367 655 3.0E-17
sp|A4YEC1|DPO4_METS5 DNA polymerase IV OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=dbh PE=3 SV=1 367 607 4.0E-17
sp|Q3ZAI3|DPO4_DEHM1 DNA polymerase IV OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=dinB PE=3 SV=1 367 630 4.0E-17
sp|Q49426|Y360_MYCGE Uncharacterized protein MG360 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG360 PE=3 SV=1 367 564 2.0E-16
sp|P9WNT3|DPO41_MYCTU DNA polymerase IV 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dinB1 PE=1 SV=1 363 669 4.0E-16
sp|P9WNT2|DPO41_MYCTO DNA polymerase IV 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dinB1 PE=3 SV=1 363 669 4.0E-16
sp|P63986|DPO41_MYCBO DNA polymerase IV 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dinB1 PE=3 SV=1 363 669 4.0E-16
sp|Q97MB3|DPO4_CLOAB DNA polymerase IV OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dinB PE=3 SV=1 367 655 1.0E-15
sp|Q8H2D5|POLH_ARATH DNA polymerase eta OS=Arabidopsis thaliana GN=POLH PE=1 SV=1 367 655 9.0E-15
sp|Q9UBT6|POLK_HUMAN DNA polymerase kappa OS=Homo sapiens GN=POLK PE=1 SV=1 367 669 3.0E-14
sp|Q920Q2|REV1_MOUSE DNA repair protein REV1 OS=Mus musculus GN=Rev1 PE=1 SV=1 13 161 4.0E-14
sp|Q9UBZ9|REV1_HUMAN DNA repair protein REV1 OS=Homo sapiens GN=REV1 PE=1 SV=1 13 148 5.0E-14
sp|Q5R4N7|REV1_PONAB DNA repair protein REV1 OS=Pongo abelii GN=REV1 PE=2 SV=1 13 148 5.0E-14
sp|Q9KCU7|DPO41_BACHD DNA polymerase IV 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dinB1 PE=3 SV=1 367 611 5.0E-13
sp|Q9K9A8|DPO42_BACHD DNA polymerase IV 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dinB2 PE=3 SV=1 367 677 7.0E-13
sp|Q4KWZ7|REV1_CHICK DNA repair protein REV1 OS=Gallus gallus GN=REV1 PE=2 SV=1 29 162 1.0E-12
sp|Q2RJ46|DPO4_MOOTA DNA polymerase IV OS=Moorella thermoacetica (strain ATCC 39073) GN=dinB PE=3 SV=1 367 655 4.0E-12
sp|A5D243|DPO4_PELTS DNA polymerase IV OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=dinB PE=3 SV=1 367 668 4.0E-12
sp|Q9QUG2|POLK_MOUSE DNA polymerase kappa OS=Mus musculus GN=Polk PE=1 SV=1 327 473 7.0E-12
sp|P75241|Y537_MYCPN Uncharacterized protein MG360 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_537 PE=3 SV=1 384 564 1.0E-10
sp|Q4KWZ7|REV1_CHICK DNA repair protein REV1 OS=Gallus gallus GN=REV1 PE=2 SV=1 308 401 8.0E-07
sp|Q9QUG2|POLK_MOUSE DNA polymerase kappa OS=Mus musculus GN=Polk PE=1 SV=1 499 669 2.0E-06
sp|P54560|DPO42_BACSU DNA polymerase IV 2 OS=Bacillus subtilis (strain 168) GN=dinB2 PE=3 SV=1 367 615 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003684 damaged DNA binding Yes
GO:0006281 DNA repair Yes
GO:0097159 organic cyclic compound binding No
GO:0003677 DNA binding No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0050896 response to stimulus No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003676 nucleic acid binding No
GO:0006259 DNA metabolic process No
GO:0009987 cellular process No
GO:0006950 response to stress No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0033554 cellular response to stress No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0051716 cellular response to stimulus No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10701
MGSVLDKNSSSVRKRIENHAFQDEDGEEYEASKFHGFGDYFRRKKIKLQNLDAETRAASEKPEIFKGVVAHITGF
TQPPLHVLHREIVQHGGGFLQYLDSKTMATHIIASTLPPKKTVDFSRYRIVKPAWIMDSIRAGRLLPWADYRVLD
EGPRQKTLKLDSDKGLSQASPQARRGYREQTDNGFYTSQMKGSVTTLPSQDLSQLAEKLQTPGKPLATGRMTDLP
NGQSSGEAASTAGLASTDQKPSTLGARGSREVASASASVQEPLPPGSESDNLAPQIEAPHAKEAPRDMTSEEHNS
WLLSDPRLRKSSTANPDFLKQFYSESRLHHLSTWKANLKTAMQRLAAEKGLSSQKKLRKRPGERGYIMHVDFDSF
FCAVSLKRHPEYVDLPSVVAHGSGPGSEIASCNYPAREFGVKNGMWMRRALELCPDLKVLPYDFPGYEEASRQFY
ECILSVGGIVQSVSVDEALIDATAIVLSASDSQGVGIDEGSVWREQQKADGLARTLREQIKVQTGCAVSVGIGGN
ILQAKIALRKAKPAGQFQLKPEDVLHVIGELRVEELPGVSYSIGGKLEEVGVRYVKDIRDVSRERLASALGPKTG
DRLADYARGIDRSEVGEQPPRKSVSAEVNWGIRFISQQEAEEFVYNLCKELEKRLVGEQVRGKHLTVKIMRRCLD
APLDPAKHLGHGRCDTFSKSIAFGVATHSYEAIGREAVSILRSYKFSPGDLRGLGVQMTKLEPIKTSASAPEGSQ
RILPFTTFTAPSPANRTPKAEQIDDVESPRKRRGAGSRDIGEDPIAEDPVTPRRPRVHPAMALSRAAEEDAKANT
PLNVSGTQFIIPSNPDPAVIAELPYDIRSRLMGQGARPSPAKLEPRPGSPVSAETLLPSQVDAEVFNALPEDMKA
EVLATYGRKPAQQPQRPSPRRDRDQAAPPRKQTTPTKRGGMRGGLAGRAQRRKDARSGVMQTNFRAIKHGDEAPA
QDEIEELDPSFLAELPEDVRKEVVADHRRRRLARRSGLDAPARRNRTPDVDNGLGGGQRRIQFPAPPRKVPFAGL
GATSSRDIKEMLDTWHKETQGDGPHGEDVEVFGKYLCQVVSEEGDMQKVAVLVKWLKLLVEQDGEDGPGRASWRK
ALGQVRSAVQEAVGQRGLGPLDI*
Coding >Hirsu2|10701
ATGGGAAGTGTTTTGGATAAAAACTCATCTTCGGTGAGGAAACGAATCGAGAACCACGCCTTCCAGGACGAGGAC
GGTGAGGAATACGAGGCGAGCAAGTTCCATGGCTTTGGAGACTATTTCCGGCGCAAAAAGATCAAGCTGCAGAAC
CTGGACGCCGAGACACGCGCTGCGTCCGAAAAGCCTGAGATATTCAAGGGTGTCGTCGCCCACATTACCGGATTC
ACGCAACCGCCTCTTCACGTCCTCCATCGCGAAATCGTTCAGCATGGCGGCGGCTTCCTTCAGTACCTCGACTCC
AAGACAATGGCGACTCACATCATCGCATCGACGCTGCCGCCCAAGAAGACAGTCGACTTCAGTCGGTACAGGATT
GTGAAGCCGGCCTGGATCATGGACTCCATCCGAGCCGGAAGGCTCTTGCCGTGGGCCGACTACCGAGTTCTAGAC
GAAGGCCCAAGACAGAAGACTCTCAAGCTTGACAGCGACAAGGGTCTCTCACAGGCCAGCCCGCAGGCCAGGCGG
GGATACAGAGAACAGACGGACAACGGCTTCTACACCAGTCAAATGAAGGGCTCCGTGACGACTCTGCCCAGCCAG
GACCTAAGCCAGCTGGCCGAAAAGTTACAGACACCGGGAAAGCCGCTGGCGACAGGCCGGATGACCGACCTGCCA
AACGGTCAAAGTTCCGGCGAAGCGGCCAGTACCGCCGGTCTAGCGTCCACGGATCAGAAGCCGAGCACTCTCGGC
GCCCGCGGATCTCGGGAAGTTGCATCAGCGTCGGCATCAGTCCAAGAGCCGCTGCCCCCTGGATCCGAGTCGGAT
AATTTGGCCCCCCAAATAGAAGCGCCCCATGCGAAGGAAGCCCCAAGGGACATGACTTCAGAGGAACACAATTCT
TGGCTACTGTCAGACCCCCGGCTGCGAAAGTCGTCCACGGCAAACCCCGACTTTTTGAAGCAGTTCTACTCAGAA
AGCCGGCTGCACCATCTGTCGACGTGGAAGGCAAACCTGAAGACAGCGATGCAACGATTGGCAGCCGAGAAAGGC
CTTTCTTCTCAGAAGAAACTCAGAAAACGACCAGGGGAGAGAGGGTACATCATGCACGTCGACTTCGACAGCTTC
TTCTGCGCTGTCTCACTAAAGCGACACCCGGAATATGTCGATCTGCCGTCGGTCGTGGCTCACGGATCCGGGCCG
GGATCCGAGATTGCCAGCTGCAATTATCCGGCACGAGAATTTGGCGTCAAAAACGGAATGTGGATGCGACGCGCC
CTTGAGCTATGTCCGGACCTCAAAGTACTGCCGTATGACTTTCCTGGGTACGAGGAGGCCAGCCGGCAGTTCTAC
GAATGCATCCTATCTGTGGGCGGCATTGTTCAGAGCGTGAGCGTTGACGAAGCCTTGATCGACGCAACAGCCATT
GTCTTGTCCGCTTCCGACTCTCAGGGAGTCGGCATAGACGAAGGGAGTGTTTGGCGAGAGCAGCAGAAGGCGGAC
GGACTTGCCCGCACCCTGCGGGAGCAGATCAAAGTTCAGACGGGCTGCGCGGTTTCGGTCGGAATCGGGGGCAAC
ATCCTTCAGGCCAAGATTGCGCTGAGGAAAGCCAAGCCGGCCGGTCAGTTCCAGCTCAAGCCGGAGGATGTTCTC
CACGTCATCGGGGAGCTGAGGGTCGAGGAACTACCGGGAGTGTCGTACAGCATCGGCGGCAAGCTCGAGGAGGTG
GGCGTCCGATACGTCAAGGACATCCGGGACGTGTCTAGAGAGCGGCTGGCGTCGGCACTGGGGCCCAAGACGGGC
GACAGGCTCGCAGACTACGCCCGGGGAATCGACCGCAGCGAGGTCGGGGAGCAGCCACCTCGGAAGTCGGTGTCG
GCCGAGGTCAACTGGGGCATCCGCTTCATCAGCCAGCAGGAAGCCGAGGAGTTCGTTTACAACCTGTGCAAGGAG
CTGGAAAAGCGGCTGGTGGGCGAACAGGTCCGCGGGAAACACCTCACCGTGAAGATCATGAGGAGATGTCTCGAT
GCACCACTCGATCCCGCAAAGCACCTGGGCCACGGACGATGCGACACCTTCAGCAAGAGCATCGCATTCGGAGTC
GCGACGCATAGTTACGAGGCCATCGGTCGGGAGGCCGTGTCCATACTGCGTTCCTACAAATTCAGCCCCGGAGAC
TTGCGGGGCCTCGGCGTACAAATGACGAAGCTGGAGCCGATCAAGACGAGCGCGAGCGCGCCGGAAGGCAGCCAA
CGGATCCTGCCCTTCACCACGTTTACGGCGCCGTCTCCCGCCAACAGGACGCCCAAGGCGGAGCAGATCGACGAT
GTCGAGAGTCCGCGCAAACGGAGAGGTGCCGGAAGCCGCGATATCGGCGAGGATCCCATCGCCGAAGACCCCGTG
ACGCCTCGGAGGCCCAGAGTTCACCCGGCCATGGCCCTATCGAGAGCGGCCGAAGAAGACGCCAAGGCCAACACG
CCGCTCAACGTGTCGGGCACCCAGTTCATCATCCCCAGCAACCCCGATCCGGCCGTCATTGCGGAGTTACCCTAC
GACATACGGAGCAGGCTAATGGGTCAGGGGGCGAGGCCGAGCCCCGCGAAGCTGGAGCCAAGGCCAGGTAGCCCC
GTCTCCGCAGAGACGCTGCTGCCATCGCAAGTCGACGCCGAGGTCTTCAACGCCCTGCCCGAGGACATGAAAGCC
GAGGTGCTGGCAACGTACGGTCGAAAGCCTGCGCAGCAGCCACAGCGACCATCGCCGCGGCGGGATCGGGACCAA
GCCGCGCCGCCGAGAAAGCAGACGACGCCGACGAAGCGGGGTGGAATGCGGGGGGGGCTGGCCGGCAGGGCGCAA
CGGCGAAAGGACGCGCGCTCGGGCGTGATGCAGACGAATTTCAGGGCTATCAAGCACGGCGACGAGGCGCCCGCA
CAGGACGAGATCGAGGAGCTCGATCCCAGCTTCCTGGCGGAACTGCCCGAGGACGTGCGCAAAGAAGTGGTGGCC
GACCATCGGCGGCGGCGACTCGCGCGCCGCTCGGGGCTGGACGCGCCGGCCCGCCGGAATCGCACGCCCGACGTC
GACAACGGCCTTGGCGGAGGCCAGAGGCGGATCCAATTCCCGGCGCCGCCGCGAAAGGTGCCGTTTGCCGGCCTC
GGCGCCACGTCAAGCCGGGATATCAAAGAGATGCTGGACACGTGGCACAAGGAGACGCAGGGCGACGGGCCGCAC
GGTGAGGACGTCGAGGTCTTTGGAAAGTATCTGTGCCAAGTGGTGAGCGAGGAAGGGGACATGCAGAAGGTGGCG
GTGCTGGTCAAGTGGTTGAAGCTCTTGGTGGAACAGGATGGCGAGGACGGGCCCGGGCGCGCGTCGTGGCGCAAG
GCGCTGGGCCAGGTACGAAGTGCCGTACAGGAGGCAGTCGGACAGCGAGGACTCGGGCCATTGGATATCTAG
Transcript >Hirsu2|10701
ATGGGAAGTGTTTTGGATAAAAACTCATCTTCGGTGAGGAAACGAATCGAGAACCACGCCTTCCAGGACGAGGAC
GGTGAGGAATACGAGGCGAGCAAGTTCCATGGCTTTGGAGACTATTTCCGGCGCAAAAAGATCAAGCTGCAGAAC
CTGGACGCCGAGACACGCGCTGCGTCCGAAAAGCCTGAGATATTCAAGGGTGTCGTCGCCCACATTACCGGATTC
ACGCAACCGCCTCTTCACGTCCTCCATCGCGAAATCGTTCAGCATGGCGGCGGCTTCCTTCAGTACCTCGACTCC
AAGACAATGGCGACTCACATCATCGCATCGACGCTGCCGCCCAAGAAGACAGTCGACTTCAGTCGGTACAGGATT
GTGAAGCCGGCCTGGATCATGGACTCCATCCGAGCCGGAAGGCTCTTGCCGTGGGCCGACTACCGAGTTCTAGAC
GAAGGCCCAAGACAGAAGACTCTCAAGCTTGACAGCGACAAGGGTCTCTCACAGGCCAGCCCGCAGGCCAGGCGG
GGATACAGAGAACAGACGGACAACGGCTTCTACACCAGTCAAATGAAGGGCTCCGTGACGACTCTGCCCAGCCAG
GACCTAAGCCAGCTGGCCGAAAAGTTACAGACACCGGGAAAGCCGCTGGCGACAGGCCGGATGACCGACCTGCCA
AACGGTCAAAGTTCCGGCGAAGCGGCCAGTACCGCCGGTCTAGCGTCCACGGATCAGAAGCCGAGCACTCTCGGC
GCCCGCGGATCTCGGGAAGTTGCATCAGCGTCGGCATCAGTCCAAGAGCCGCTGCCCCCTGGATCCGAGTCGGAT
AATTTGGCCCCCCAAATAGAAGCGCCCCATGCGAAGGAAGCCCCAAGGGACATGACTTCAGAGGAACACAATTCT
TGGCTACTGTCAGACCCCCGGCTGCGAAAGTCGTCCACGGCAAACCCCGACTTTTTGAAGCAGTTCTACTCAGAA
AGCCGGCTGCACCATCTGTCGACGTGGAAGGCAAACCTGAAGACAGCGATGCAACGATTGGCAGCCGAGAAAGGC
CTTTCTTCTCAGAAGAAACTCAGAAAACGACCAGGGGAGAGAGGGTACATCATGCACGTCGACTTCGACAGCTTC
TTCTGCGCTGTCTCACTAAAGCGACACCCGGAATATGTCGATCTGCCGTCGGTCGTGGCTCACGGATCCGGGCCG
GGATCCGAGATTGCCAGCTGCAATTATCCGGCACGAGAATTTGGCGTCAAAAACGGAATGTGGATGCGACGCGCC
CTTGAGCTATGTCCGGACCTCAAAGTACTGCCGTATGACTTTCCTGGGTACGAGGAGGCCAGCCGGCAGTTCTAC
GAATGCATCCTATCTGTGGGCGGCATTGTTCAGAGCGTGAGCGTTGACGAAGCCTTGATCGACGCAACAGCCATT
GTCTTGTCCGCTTCCGACTCTCAGGGAGTCGGCATAGACGAAGGGAGTGTTTGGCGAGAGCAGCAGAAGGCGGAC
GGACTTGCCCGCACCCTGCGGGAGCAGATCAAAGTTCAGACGGGCTGCGCGGTTTCGGTCGGAATCGGGGGCAAC
ATCCTTCAGGCCAAGATTGCGCTGAGGAAAGCCAAGCCGGCCGGTCAGTTCCAGCTCAAGCCGGAGGATGTTCTC
CACGTCATCGGGGAGCTGAGGGTCGAGGAACTACCGGGAGTGTCGTACAGCATCGGCGGCAAGCTCGAGGAGGTG
GGCGTCCGATACGTCAAGGACATCCGGGACGTGTCTAGAGAGCGGCTGGCGTCGGCACTGGGGCCCAAGACGGGC
GACAGGCTCGCAGACTACGCCCGGGGAATCGACCGCAGCGAGGTCGGGGAGCAGCCACCTCGGAAGTCGGTGTCG
GCCGAGGTCAACTGGGGCATCCGCTTCATCAGCCAGCAGGAAGCCGAGGAGTTCGTTTACAACCTGTGCAAGGAG
CTGGAAAAGCGGCTGGTGGGCGAACAGGTCCGCGGGAAACACCTCACCGTGAAGATCATGAGGAGATGTCTCGAT
GCACCACTCGATCCCGCAAAGCACCTGGGCCACGGACGATGCGACACCTTCAGCAAGAGCATCGCATTCGGAGTC
GCGACGCATAGTTACGAGGCCATCGGTCGGGAGGCCGTGTCCATACTGCGTTCCTACAAATTCAGCCCCGGAGAC
TTGCGGGGCCTCGGCGTACAAATGACGAAGCTGGAGCCGATCAAGACGAGCGCGAGCGCGCCGGAAGGCAGCCAA
CGGATCCTGCCCTTCACCACGTTTACGGCGCCGTCTCCCGCCAACAGGACGCCCAAGGCGGAGCAGATCGACGAT
GTCGAGAGTCCGCGCAAACGGAGAGGTGCCGGAAGCCGCGATATCGGCGAGGATCCCATCGCCGAAGACCCCGTG
ACGCCTCGGAGGCCCAGAGTTCACCCGGCCATGGCCCTATCGAGAGCGGCCGAAGAAGACGCCAAGGCCAACACG
CCGCTCAACGTGTCGGGCACCCAGTTCATCATCCCCAGCAACCCCGATCCGGCCGTCATTGCGGAGTTACCCTAC
GACATACGGAGCAGGCTAATGGGTCAGGGGGCGAGGCCGAGCCCCGCGAAGCTGGAGCCAAGGCCAGGTAGCCCC
GTCTCCGCAGAGACGCTGCTGCCATCGCAAGTCGACGCCGAGGTCTTCAACGCCCTGCCCGAGGACATGAAAGCC
GAGGTGCTGGCAACGTACGGTCGAAAGCCTGCGCAGCAGCCACAGCGACCATCGCCGCGGCGGGATCGGGACCAA
GCCGCGCCGCCGAGAAAGCAGACGACGCCGACGAAGCGGGGTGGAATGCGGGGGGGGCTGGCCGGCAGGGCGCAA
CGGCGAAAGGACGCGCGCTCGGGCGTGATGCAGACGAATTTCAGGGCTATCAAGCACGGCGACGAGGCGCCCGCA
CAGGACGAGATCGAGGAGCTCGATCCCAGCTTCCTGGCGGAACTGCCCGAGGACGTGCGCAAAGAAGTGGTGGCC
GACCATCGGCGGCGGCGACTCGCGCGCCGCTCGGGGCTGGACGCGCCGGCCCGCCGGAATCGCACGCCCGACGTC
GACAACGGCCTTGGCGGAGGCCAGAGGCGGATCCAATTCCCGGCGCCGCCGCGAAAGGTGCCGTTTGCCGGCCTC
GGCGCCACGTCAAGCCGGGATATCAAAGAGATGCTGGACACGTGGCACAAGGAGACGCAGGGCGACGGGCCGCAC
GGTGAGGACGTCGAGGTCTTTGGAAAGTATCTGTGCCAAGTGGTGAGCGAGGAAGGGGACATGCAGAAGGTGGCG
GTGCTGGTCAAGTGGTTGAAGCTCTTGGTGGAACAGGATGGCGAGGACGGGCCCGGGCGCGCGTCGTGGCGCAAG
GCGCTGGGCCAGGTACGAAGTGCCGTACAGGAGGCAGTCGGACAGCGAGGACTCGGGCCATTGGATATCTAG
Gene >Hirsu2|10701
ATGGGAAGTGTTTTGGATAAAAACTCATCTTCGGTGAGGAAACGAATCGAGAACCACGCCTTCCAGGACGAGGAC
GGTGAGGAATACGAGGCGAGCAAGTTCCATGGCTTTGGAGACTATTTCCGGCGCAAAAAGATCAAGCTGCAGAAC
CTGGACGCCGAGACACGCGCTGCGTCCGAAAAGCCTGAGATATTCAAGGGTGTCGTCGCCCACATTACCGGATTC
ACGCAACCGCCTCTTCACGTGTGCGTCCTCATTTTCCCTTCTGCCTTGTTCGACGCTGACATGGGCCATCAGCCT
CCATCGCGAAATCGTTCAGCATGGCGGCGGCTTCCTTCAGTACCTCGACTCCAAGACAATGGCGACTCACATCAT
CGCATCGACGCTGCCGCCCAAGAAGACAGTCGACTTCAGTCGGTACAGGATTGTGAAGCCGGCCTGGATCATGGA
CTCCATCCGAGCCGGAAGGCTCTTGCCGTGGGCCGACTACCGAGTTCTAGACGAAGGCCCAAGACAGAAGACTCT
CAAGCTTGACAGCGACAAGGGTCTCTCACAGGCCAGCCCGCAGGCCAGGCGGGGATACAGAGAACAGACGGACAA
CGGCTTCTACACCAGTCAAATGAAGGGCTCCGTGACGACTCTGCCCAGCCAGGACCTAAGCCAGCTGGCCGAAAA
GTTACAGACACCGGGAAAGCCGCTGGCGACAGGCCGGATGACCGACCTGCCAAACGGTCAAAGTTCCGGCGAAGC
GGCCAGTACCGCCGGTCTAGCGTCCACGGATCAGAAGCCGAGCACTCTCGGCGCCCGCGGATCTCGGGAAGTTGC
ATCAGCGTCGGCATCAGTCCAAGAGCCGCTGCCCCCTGGATCCGAGTCGGATAATTTGGCCCCCCAAATAGAAGC
GCCCCATGCGAAGGAAGCCCCAAGGGACATGACTTCAGAGGAACACAATTCTTGGCTACTGTCAGACCCCCGGCT
GCGAAAGTCGTCCACGGCAAACCCCGACTTTTTGAAGCAGTTCTACTCAGAAAGCCGGCTGCACCATCTGTCGAC
GTGGAAGGCAAACCTGAAGACAGCGATGCAACGATTGGCAGCCGAGAAAGGCCTTTCTTCTCAGAAGAAACTCAG
AAAACGACCAGGGGAGAGAGGGTACATCATGCACGTCGACTTCGACAGCTTCTTCTGCGCTGTCTCACTAAAGCG
ACACCCGGAATATGTCGATCTGCCGTCGGTCGTGGCTCACGGATCCGGGCCGGGATCCGAGATTGCCAGCTGCAA
TTATCCGGCACGAGAATTTGGCGTCAAAAACGGAATGTGGATGCGACGCGCCCTTGAGCTATGTCCGGACCTCAA
AGTACTGCCGTATGACTTTCCTGGGTACGAGGAGGCCAGCCGGCAGTTCTACGAATGCATCCTATCTGTGGGCGG
CATTGTTCAGAGCGTGAGCGTTGACGAAGCCTTGATCGACGCAACAGCCATTGTCTTGTCCGCTTCCGACTCTCA
GGGAGTCGGCATAGACGAAGGGAGTGTTTGGCGAGAGCAGCAGAAGGCGGACGGACTTGCCCGCACCCTGCGGGA
GCAGATCAAAGTTCAGACGGGCTGCGCGGTTTCGGTCGGAATCGGGGGCAACATCCTTCAGGCCAAGATTGCGCT
GAGGAAAGCCAAGCCGGCCGGTCAGTTCCAGCTCAAGCCGGAGGATGTTCTCCACGTCATCGGGGAGCTGAGGGT
CGAGGAACTACCGGGAGTGTCGTACAGCATCGGCGGCAAGCTCGAGGAGGTGGGCGTCCGATACGTCAAGGACAT
CCGGGACGTGTCTAGAGAGCGGCTGGCGTCGGCACTGGGGCCCAAGACGGGCGACAGGCTCGCAGACTACGCCCG
GGGAATCGACCGCAGCGAGGTCGGGGAGCAGCCACCTCGGAAGTCGGTGTCGGCCGAGGTCAACTGGGGCATCCG
CTTCATCAGCCAGCAGGAAGCCGAGGAGTTCGTTTACAACCTGTGCAAGGAGCTGGAAAAGCGGCTGGTGGGCGA
ACAGGTCCGCGGGAAACACCTCACCGTGAAGATCATGAGGAGATGTCTCGATGCACCACTCGATCCCGCAAAGCA
CCTGGGCCACGGACGATGCGACACCTTCAGCAAGAGCATCGCATTCGGAGTCGCGACGCATAGTTACGAGGCCAT
CGGTCGGGAGGCCGTGTCCATACTGCGTTCCTACAAATTCAGCCCCGGAGACTTGCGGGGCCTCGGCGTACAAAT
GACGAAGCTGGAGCCGATCAAGACGAGCGCGAGCGCGCCGGAAGGCAGCCAACGGATCCTGCCCTTCACCACGTT
TACGGCGCCGTCTCCCGCCAACAGGACGCCCAAGGCGGAGCAGATCGACGATGTCGAGAGTCCGCGCAAACGGAG
AGGTGCCGGAAGCCGCGATATCGGCGAGGATCCCATCGCCGAAGACCCCGTGACGCCTCGGAGGCCCAGAGTTCA
CCCGGCCATGGCCCTATCGAGAGCGGCCGAAGAAGACGCCAAGGCCAACACGCCGCTCAACGTGTCGGGCACCCA
GTTCATCATCCCCAGCAACCCCGATCCGGCCGTCATTGCGGAGTTACCCTACGACATACGGAGCAGGCTAATGGG
TCAGGGGGCGAGGCCGAGCCCCGCGAAGCTGGAGCCAAGGCCAGGTAGCCCCGTCTCCGCAGAGACGCTGCTGCC
ATCGCAAGTCGACGCCGAGGTCTTCAACGCCCTGCCCGAGGACATGAAAGCCGAGGTGCTGGCAACGTACGGTCG
AAAGCCTGCGCAGCAGCCACAGCGACCATCGCCGCGGCGGGATCGGGACCAAGCCGCGCCGCCGAGAAAGCAGAC
GACGCCGACGAAGCGGGGTGGAATGCGGGGGGGGCTGGCCGGCAGGGCGCAACGGCGAAAGGACGCGCGCTCGGG
CGTGATGCAGACGAATTTCAGGGCTATCAAGCACGGCGACGAGGCGCCCGCACAGGACGAGATCGAGGAGCTCGA
TCCCAGCTTCCTGGCGGAACTGCCCGAGGACGTGCGCAAAGAAGTGGTGGCCGACCATCGGCGGCGGCGACTCGC
GCGCCGCTCGGGGCTGGACGCGCCGGCCCGCCGGAATCGCACGCCCGACGTCGACAACGGCCTTGGCGGAGGCCA
GAGGCGGATCCAATTCCCGGCGCCGCCGCGAAAGGTGCCGTTTGCCGGCCTCGGCGCCACGTCAAGCCGGGATAT
CAAAGAGATGCTGGACACGTGGCACAAGGAGACGCAGGGCGACGGGCCGCACGGTGAGGACGTCGAGGTCTTTGG
AAAGTATCTGTGCCAAGTGGTGAGCGAGGAAGGGGACATGCAGAAGGTGGCGGTGCTGGTCAAGTGGTTGAAGCT
CTTGGTGGAACAGGATGGCGAGGACGGGCCCGGGCGCGCGTCGTGGCGCAAGGCGCTGGGCCAGGTACGAAGTGC
CGTACAGGAGGCAGTCGGACAGCGAGGACTCGGGCCATTGGATATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail