Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10700
Gene name
LocationContig_892:1552..3254
Strand-
Gene length (bp)1702
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07808 RED_N RED-like protein N-terminal region 3.0E-06 82 201

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4372 0.8797 0.0376 0.068 0.037 0.0008 0.067 0.018 0.018 0.0653

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1332
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|219
Ophiocordyceps australis map64 (Brazil) OphauB2|508
Ophiocordyceps camponoti-floridani Ophcf2|07269
Ophiocordyceps camponoti-rufipedis Ophun1|3055
Ophiocordyceps kimflemingae Ophio5|1895
Ophiocordyceps subramaniannii Hirsu2|10700 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10700
MNNNQFRKLVLANSEQPASTASGSPPSTGGQTGKGSLGSRERATIPMTPRSVASAQSVFARQLAERNQAVNPHKK
FKTSAPKGVKLASGYVDRSSERHEETADDRKEKLESLEKSLRNGEIDRETYDKLRFDIAGGSLESTHLVKGLDFK
LLERIKRGDNVYGKKAKDEAKDDGPGTKDIEDEFEELEQREVQAIEKVKQEKKTGQLATVPAVSGKKRTRDQILA
ELKASREAAKAPKVSSLGSRFKRIGTKHKPGARIERDSKGREVLIIVDEDGHEKRKVRKLKPGEEEDEAGNGLLM
PDPKAKPLGMEVPEEYRKQAEPEEDLDADIFSDVGDDYDPLAGLEASDSDSDSDSDADGAESKASGMAAEASGEH
KEKDASNALDREKMPPPPKPKPTAAPRNYFQDSKTGLMSTEATQGPSMSDPAIMAAIKRAAALGPVRGDGDDDDD
KTEEKAREMEERRKKLLQMSARDDEDIDMGFGTSRFEDEDDFDEQRVKLSVWGAEAGGQGQGQNRSGQSRRKRGP
KKRKGDANSAADVMRVMEERKKS*
Coding >Hirsu2|10700
ATGAACAACAATCAGTTTCGCAAGCTCGTGCTTGCAAACTCGGAGCAGCCGGCCAGCACAGCGAGCGGATCTCCT
CCTTCGACTGGCGGCCAGACCGGCAAAGGGTCGCTCGGTTCGCGGGAACGAGCCACCATACCCATGACACCTCGC
TCCGTTGCGAGCGCTCAGTCCGTATTCGCACGACAGCTCGCCGAACGGAACCAAGCAGTCAACCCGCACAAGAAG
TTCAAGACGTCCGCGCCAAAAGGCGTGAAGCTGGCCTCGGGCTACGTGGATCGATCGAGCGAACGGCACGAGGAG
ACGGCCGACGATAGAAAGGAGAAACTCGAGTCGCTGGAAAAGTCTCTGAGGAATGGCGAGATCGACAGAGAGACG
TACGACAAGCTGAGATTTGACATCGCCGGCGGCTCTCTGGAGAGCACCCATCTAGTCAAGGGGCTAGACTTTAAG
CTCCTGGAGAGGATAAAGAGAGGAGACAACGTGTACGGGAAGAAGGCCAAAGACGAGGCGAAAGATGACGGGCCT
GGCACCAAGGACATCGAGGATGAATTCGAAGAGCTCGAACAGCGCGAAGTGCAAGCTATCGAAAAGGTCAAGCAG
GAGAAGAAGACGGGGCAGTTGGCGACGGTCCCGGCCGTATCGGGCAAGAAGCGAACACGAGACCAGATTCTGGCG
GAGCTCAAAGCGTCGAGAGAGGCGGCAAAGGCTCCAAAGGTGTCTTCGCTGGGGAGCAGGTTCAAGCGGATCGGG
ACCAAGCATAAGCCGGGCGCCCGGATAGAGCGCGACAGCAAGGGCAGGGAAGTGCTGATTATCGTGGACGAAGAT
GGCCACGAGAAAAGAAAGGTGCGGAAGCTGAAACCTGGAGAAGAGGAGGACGAGGCCGGAAACGGCCTCTTGATG
CCGGACCCCAAGGCCAAACCTCTGGGCATGGAGGTGCCTGAAGAGTATAGGAAACAGGCAGAGCCCGAAGAGGAC
TTGGATGCCGACATTTTCAGCGACGTCGGAGACGACTACGATCCGTTGGCCGGTCTGGAGGCTTCCGATTCCGAC
TCCGACTCCGACTCTGATGCAGATGGAGCTGAGTCGAAGGCGAGCGGGATGGCTGCAGAGGCGTCTGGCGAGCAC
AAGGAGAAGGATGCCTCAAACGCGTTGGACAGAGAGAAGATGCCGCCGCCGCCGAAGCCGAAGCCGACTGCAGCG
CCTCGAAACTACTTTCAGGACTCGAAGACGGGCCTCATGTCCACGGAAGCGACGCAAGGGCCATCCATGTCCGAC
CCGGCAATCATGGCCGCCATCAAGAGAGCGGCAGCGCTTGGTCCCGTGAGGGGCGATGGCGACGACGACGACGAC
AAGACGGAAGAGAAGGCCCGGGAGATGGAGGAGCGGCGGAAGAAACTGCTGCAAATGAGCGCGAGGGACGACGAG
GACATCGACATGGGTTTCGGGACGAGCAGGTTCGAGGACGAGGACGACTTTGACGAGCAGAGGGTCAAGCTGTCG
GTCTGGGGCGCCGAGGCCGGGGGTCAGGGGCAGGGGCAGAACAGGAGCGGGCAGTCGAGGAGGAAGAGAGGACCG
AAGAAGCGCAAGGGCGACGCCAACAGCGCGGCGGACGTGATGCGCGTCATGGAGGAGCGGAAGAAGTCGTGA
Transcript >Hirsu2|10700
ATGAACAACAATCAGTTTCGCAAGCTCGTGCTTGCAAACTCGGAGCAGCCGGCCAGCACAGCGAGCGGATCTCCT
CCTTCGACTGGCGGCCAGACCGGCAAAGGGTCGCTCGGTTCGCGGGAACGAGCCACCATACCCATGACACCTCGC
TCCGTTGCGAGCGCTCAGTCCGTATTCGCACGACAGCTCGCCGAACGGAACCAAGCAGTCAACCCGCACAAGAAG
TTCAAGACGTCCGCGCCAAAAGGCGTGAAGCTGGCCTCGGGCTACGTGGATCGATCGAGCGAACGGCACGAGGAG
ACGGCCGACGATAGAAAGGAGAAACTCGAGTCGCTGGAAAAGTCTCTGAGGAATGGCGAGATCGACAGAGAGACG
TACGACAAGCTGAGATTTGACATCGCCGGCGGCTCTCTGGAGAGCACCCATCTAGTCAAGGGGCTAGACTTTAAG
CTCCTGGAGAGGATAAAGAGAGGAGACAACGTGTACGGGAAGAAGGCCAAAGACGAGGCGAAAGATGACGGGCCT
GGCACCAAGGACATCGAGGATGAATTCGAAGAGCTCGAACAGCGCGAAGTGCAAGCTATCGAAAAGGTCAAGCAG
GAGAAGAAGACGGGGCAGTTGGCGACGGTCCCGGCCGTATCGGGCAAGAAGCGAACACGAGACCAGATTCTGGCG
GAGCTCAAAGCGTCGAGAGAGGCGGCAAAGGCTCCAAAGGTGTCTTCGCTGGGGAGCAGGTTCAAGCGGATCGGG
ACCAAGCATAAGCCGGGCGCCCGGATAGAGCGCGACAGCAAGGGCAGGGAAGTGCTGATTATCGTGGACGAAGAT
GGCCACGAGAAAAGAAAGGTGCGGAAGCTGAAACCTGGAGAAGAGGAGGACGAGGCCGGAAACGGCCTCTTGATG
CCGGACCCCAAGGCCAAACCTCTGGGCATGGAGGTGCCTGAAGAGTATAGGAAACAGGCAGAGCCCGAAGAGGAC
TTGGATGCCGACATTTTCAGCGACGTCGGAGACGACTACGATCCGTTGGCCGGTCTGGAGGCTTCCGATTCCGAC
TCCGACTCCGACTCTGATGCAGATGGAGCTGAGTCGAAGGCGAGCGGGATGGCTGCAGAGGCGTCTGGCGAGCAC
AAGGAGAAGGATGCCTCAAACGCGTTGGACAGAGAGAAGATGCCGCCGCCGCCGAAGCCGAAGCCGACTGCAGCG
CCTCGAAACTACTTTCAGGACTCGAAGACGGGCCTCATGTCCACGGAAGCGACGCAAGGGCCATCCATGTCCGAC
CCGGCAATCATGGCCGCCATCAAGAGAGCGGCAGCGCTTGGTCCCGTGAGGGGCGATGGCGACGACGACGACGAC
AAGACGGAAGAGAAGGCCCGGGAGATGGAGGAGCGGCGGAAGAAACTGCTGCAAATGAGCGCGAGGGACGACGAG
GACATCGACATGGGTTTCGGGACGAGCAGGTTCGAGGACGAGGACGACTTTGACGAGCAGAGGGTCAAGCTGTCG
GTCTGGGGCGCCGAGGCCGGGGGTCAGGGGCAGGGGCAGAACAGGAGCGGGCAGTCGAGGAGGAAGAGAGGACCG
AAGAAGCGCAAGGGCGACGCCAACAGCGCGGCGGACGTGATGCGCGTCATGGAGGAGCGGAAGAAGTCGTGA
Gene >Hirsu2|10700
ATGAACAACAATCAGTTTCGCAAGCTCGTGCTTGCAAACTCGGAGCAGCCGGCCAGCACAGCGAGCGGATCTCCT
CCTTCGACTGGCGGCCAGACCGGCAAAGGGTCGCTCGGTTCGCGGGAACGAGCCACCATACCCATGACACCGTAC
GTCAGACATCGCCCGAGCCTGGCCGATATTGGTCTAACTGGTCTTGAGCAGTCGCTCCGTTGCGAGCGCTCAGTC
CGTATTCGCACGACAGCTCGCCGAACGGAACCAAGCAGTCAACCCGCACAAGAAGTTCAAGACGTCCGCGCCAAA
AGGCGTGAAGCTGGCCTCGGGCTACGTGGATCGATCGAGCGAACGGCACGAGGAGACGGCCGACGATAGAAAGGA
GAAACTCGAGTCGCTGGAAAAGTCTCTGAGGAATGGCGAGATCGACAGAGAGACGTACGACAAGCTGAGATTTGA
CATCGCCGGCGGCTCTCTGGAGAGCACCCATCTAGTCAAGGGGCTAGACTTTAAGCTCCTGGAGAGGATAAAGAG
AGGAGACAACGTGTACGGGAAGAAGGCCAAAGACGAGGCGAAAGATGACGGGCCTGGCACCAAGGACATCGAGGA
TGAATTCGAAGAGCTCGAACAGCGCGAAGTGCAAGCTATCGAAAAGGTCAAGCAGGAGAAGAAGACGGGGCAGTT
GGCGACGGTCCCGGCCGTATCGGGCAAGAAGCGAACACGAGACCAGATTCTGGCGGAGCTCAAAGCGTCGAGAGA
GGCGGCAAAGGCTCCAAAGGTGTCTTCGCTGGGGAGCAGGTTCAAGCGGATCGGGACCAAGCATAAGCCGGGCGC
CCGGATAGAGCGCGACAGCAAGGGCAGGGAAGTGCTGATTATCGTGGACGAAGATGGCCACGAGAAAAGAAAGGT
GCGGAAGCTGAAACCTGGAGAAGAGGAGGACGAGGCCGGAAACGGCCTCTTGATGCCGGACCCCAAGGCCAAACC
TCTGGGCATGGAGGTGCCTGAAGAGTATAGGAAACAGGCAGAGCCCGAAGAGGACTTGGATGCCGACATTTTCAG
CGACGTCGGAGACGACTACGATCCGTTGGCCGGTCTGGAGGCTTCCGATTCCGACTCCGACTCCGACTCTGATGC
AGATGGAGCTGAGTCGAAGGCGAGCGGGATGGCTGCAGAGGCGTCTGGCGAGCACAAGGAGAAGGATGCCTCAAA
CGCGTTGGACAGAGAGAAGATGCCGCCGCCGCCGAAGCCGAAGCCGACTGCAGCGCCTCGAAACTACTTTCAGGA
CTCGAAGACGGGCCTCATGTCCACGGAAGCGACGCAAGGGCCATCCATGTCCGACCCGGCAATCATGGCCGCCAT
CAAGAGAGCGGCAGCGCTTGGTCCCGTGAGGGGCGATGGCGACGACGACGACGACAAGACGGAAGAGAAGGCCCG
GGAGATGGAGGAGCGGCGGAAGAAACTGCTGCAAATGAGCGCGAGGGACGACGAGGACATCGACATGGGTTTCGG
GACGAGCAGGTTCGAGGACGAGGACGACTTTGACGAGCAGAGGGTCAAGCTGTCGGTCTGGGGCGCCGAGGCCGG
GGGTCAGGGGCAGGGGCAGAACAGGAGCGGGCAGTCGAGGAGGAAGAGAGGACCGAAGAAGCGCAAGGGCGACGC
CAACAGCGCGGCGGACGTGATGCGCGTCATGGAGGAGCGGAAGAAGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail