Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10698
Gene name
LocationContig_891:8605..10141
Strand+
Gene length (bp)1536
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 1.0E-11 264 308
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 5.8E-08 266 307
PF17123 zf-RING_11 RING-like zinc finger 1.2E-07 266 293
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 3.4E-07 266 307

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q91XF4|RN167_MOUSE E3 ubiquitin-protein ligase RNF167 OS=Mus musculus GN=Rnf167 PE=2 SV=1 234 308 1.0E-12
sp|Q5XIL0|RN167_RAT E3 ubiquitin-protein ligase RNF167 OS=Rattus norvegicus GN=Rnf167 PE=2 SV=1 234 308 1.0E-12
sp|Q9H6Y7|RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens GN=RNF167 PE=1 SV=1 264 308 3.0E-12
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 260 308 4.0E-12
sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 260 308 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q91XF4|RN167_MOUSE E3 ubiquitin-protein ligase RNF167 OS=Mus musculus GN=Rnf167 PE=2 SV=1 234 308 1.0E-12
sp|Q5XIL0|RN167_RAT E3 ubiquitin-protein ligase RNF167 OS=Rattus norvegicus GN=Rnf167 PE=2 SV=1 234 308 1.0E-12
sp|Q9H6Y7|RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens GN=RNF167 PE=1 SV=1 264 308 3.0E-12
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 260 308 4.0E-12
sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 260 308 5.0E-12
sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 260 308 5.0E-12
sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 260 308 5.0E-12
sp|Q29RU0|RN128_BOVIN E3 ubiquitin-protein ligase RNF128 OS=Bos taurus GN=RNF128 PE=2 SV=1 259 310 8.0E-12
sp|Q8TEB7|RN128_HUMAN E3 ubiquitin-protein ligase RNF128 OS=Homo sapiens GN=RNF128 PE=1 SV=1 259 310 9.0E-12
sp|Q5RF74|RN128_PONAB E3 ubiquitin-protein ligase RNF128 OS=Pongo abelii GN=RNF128 PE=2 SV=1 259 310 1.0E-11
sp|Q9D304|RN128_MOUSE E3 ubiquitin-protein ligase RNF128 OS=Mus musculus GN=Rnf128 PE=1 SV=1 259 310 1.0E-11
sp|Q8AWW4|RN128_XENLA E3 ubiquitin-protein ligase RNF128 OS=Xenopus laevis GN=rnf128 PE=2 SV=2 259 368 1.0E-11
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 260 308 2.0E-11
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 260 308 2.0E-11
sp|G3X9R7|RN148_MOUSE RING finger protein 148 OS=Mus musculus GN=Rnf148 PE=2 SV=1 264 314 2.0E-10
sp|Q8N7C7|RN148_HUMAN RING finger protein 148 OS=Homo sapiens GN=RNF148 PE=2 SV=2 264 310 3.0E-10
sp|Q8VZ14|RMR2_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Arabidopsis thaliana GN=RMR2 PE=2 SV=1 265 325 4.0E-10
sp|P87119|MU145_SCHPO RING finger protein mug145 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug145 PE=1 SV=1 264 312 5.0E-10
sp|Q2TA44|RN148_BOVIN RING finger protein 148 OS=Bos taurus GN=RNF148 PE=2 SV=1 264 310 6.0E-10
sp|Q8W571|ATL32_ARATH RING-H2 finger protein ATL32 OS=Arabidopsis thaliana GN=ATL32 PE=2 SV=3 259 326 8.0E-10
sp|Q6NRX0|RN149_XENLA E3 ubiquitin-protein ligase RNF149 OS=Xenopus laevis GN=rnf149 PE=2 SV=1 219 310 9.0E-10
sp|Q9SLC4|ATL40_ARATH RING-H2 finger protein ATL40 OS=Arabidopsis thaliana GN=ATL40 PE=2 SV=1 247 344 1.0E-09
sp|Q0WPW5|RMR4_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 4 OS=Arabidopsis thaliana GN=RMR4 PE=2 SV=1 266 332 1.0E-09
sp|Q95K04|RN133_MACFA E3 ubiquitin-protein ligase RNF133 OS=Macaca fascicularis GN=RNF133 PE=2 SV=1 263 310 2.0E-09
sp|O00237|RN103_HUMAN E3 ubiquitin-protein ligase RNF103 OS=Homo sapiens GN=RNF103 PE=1 SV=1 254 331 2.0E-09
sp|Q9R1W3|RN103_MOUSE E3 ubiquitin-protein ligase RNF103 OS=Mus musculus GN=Rnf103 PE=2 SV=2 251 331 2.0E-09
sp|F4I2Y3|RMR3_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 3 OS=Arabidopsis thaliana GN=RMR3 PE=3 SV=1 263 327 2.0E-09
sp|Q9C7I1|ATL34_ARATH RING-H2 finger protein ATL34 OS=Arabidopsis thaliana GN=ATL34 PE=2 SV=1 259 316 2.0E-09
sp|Q69U49|RMR2_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=RMR1 PE=2 SV=2 265 391 3.0E-09
sp|Q10R93|RMR1_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0167500 PE=2 SV=1 266 327 3.0E-09
sp|Q6NRV8|R111B_XENLA E3 ubiquitin-protein ligase arkadia-B OS=Xenopus laevis GN=rnf111-b PE=2 SV=1 266 316 3.0E-09
sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 264 310 3.0E-09
sp|Q06003|GOLI_DROME Protein goliath OS=Drosophila melanogaster GN=gol PE=2 SV=3 264 310 3.0E-09
sp|Q8NC42|RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens GN=RNF149 PE=2 SV=2 264 310 3.0E-09
sp|Q6ZSG1|RN165_HUMAN RING finger protein 165 OS=Homo sapiens GN=RNF165 PE=1 SV=1 264 313 4.0E-09
sp|Q3U2C5|RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus GN=Rnf149 PE=1 SV=3 264 310 4.0E-09
sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 264 310 4.0E-09
sp|Q0V9R0|RN111_XENTR E3 ubiquitin-protein ligase arkadia OS=Xenopus tropicalis GN=rnf111 PE=2 SV=1 266 316 4.0E-09
sp|Q66J97|R111C_XENLA E3 ubiquitin-protein ligase arkadia-C OS=Xenopus laevis GN=rnf111-c PE=2 SV=1 266 316 4.0E-09
sp|E9QAU8|RN165_MOUSE RING finger protein 165 OS=Mus musculus GN=Rnf165 PE=2 SV=1 264 313 4.0E-09
sp|Q9EPZ8|RN103_RAT E3 ubiquitin-protein ligase RNF103 OS=Rattus norvegicus GN=Rnf103 PE=2 SV=1 254 331 4.0E-09
sp|Q90ZT7|R111A_XENLA E3 ubiquitin-protein ligase arkadia-A (Fragment) OS=Xenopus laevis GN=rnf111-a PE=2 SV=1 266 316 5.0E-09
sp|F4HZZ4|RMR6_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 6 OS=Arabidopsis thaliana GN=RMR6 PE=3 SV=2 260 332 5.0E-09
sp|Q86XS8|GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens GN=RNF130 PE=1 SV=1 264 310 5.0E-09
sp|Q9ULK6|RN150_HUMAN RING finger protein 150 OS=Homo sapiens GN=RNF150 PE=2 SV=2 264 346 7.0E-09
sp|Q6ZNA4|RN111_HUMAN E3 ubiquitin-protein ligase Arkadia OS=Homo sapiens GN=RNF111 PE=1 SV=3 266 310 7.0E-09
sp|Q99ML9|RN111_MOUSE E3 ubiquitin-protein ligase Arkadia OS=Mus musculus GN=Rnf111 PE=1 SV=1 266 310 8.0E-09
sp|Q5R476|RN111_PONAB E3 ubiquitin-protein ligase Arkadia OS=Pongo abelii GN=RNF111 PE=2 SV=1 266 310 9.0E-09
sp|Q9LZJ6|ATL5_ARATH RING-H2 finger protein ATL5 OS=Arabidopsis thaliana GN=ATL5 PE=2 SV=1 261 332 9.0E-09
sp|Q8WVZ7|RN133_HUMAN E3 ubiquitin-protein ligase RNF133 OS=Homo sapiens GN=RNF133 PE=2 SV=1 263 310 1.0E-08
sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus GN=Rnf150 PE=2 SV=2 264 346 2.0E-08
sp|Q14B02|RN133_MOUSE E3 ubiquitin-protein ligase RNF133 OS=Mus musculus GN=Rnf133 PE=1 SV=1 263 310 2.0E-08
sp|Q566M8|RN150_DANRE RING finger protein 150 OS=Danio rerio GN=rnf150 PE=2 SV=1 264 310 2.0E-08
sp|Q9LX93|ATL55_ARATH E3 ubiquitin-protein ligase RING1 OS=Arabidopsis thaliana GN=ATL55 PE=1 SV=1 263 351 2.0E-08
sp|Q6AY01|RN133_RAT E3 ubiquitin-protein ligase RNF133 OS=Rattus norvegicus GN=Rnf133 PE=2 SV=1 263 310 3.0E-08
sp|F4HZZ5|RMR5_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 5 OS=Arabidopsis thaliana GN=RMR5 PE=2 SV=1 265 342 4.0E-08
sp|O64763|ATL9_ARATH E3 ubiquitin-protein ligase ATL9 OS=Arabidopsis thaliana GN=ATL9 PE=1 SV=1 259 310 4.0E-08
sp|Q9C1X4|YKW3_SCHPO Uncharacterized RING finger protein P32A8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP32A8.03c PE=3 SV=1 226 341 6.0E-08
sp|Q9M622|RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana GN=RMR1 PE=2 SV=1 263 313 7.0E-08
sp|Q9M0R4|ATL37_ARATH Putative RING-H2 finger protein ATL37 OS=Arabidopsis thaliana GN=ATL37 PE=3 SV=1 259 310 1.0E-07
sp|Q9P7E1|YOF7_SCHPO Uncharacterized RING finger protein P4H10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP4H10.07 PE=1 SV=1 266 308 1.0E-07
sp|Q9M0R5|ATL36_ARATH Putative RING-H2 finger protein ATL36 OS=Arabidopsis thaliana GN=ATL36 PE=3 SV=1 259 310 2.0E-07
sp|Q9SLC3|ATL41_ARATH E3 ubiquitin-protein ligase ATL41 OS=Arabidopsis thaliana GN=ATL41 PE=1 SV=1 259 324 2.0E-07
sp|Q8LDB8|RING2_ARATH E3 ubiquitin-protein ligase At1g63170 OS=Arabidopsis thaliana GN=At1g63170 PE=2 SV=2 243 310 3.0E-07
sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=1 SV=1 259 316 4.0E-07
sp|Q8WWF5|ZNRF4_HUMAN Zinc/RING finger protein 4 OS=Homo sapiens GN=ZNRF4 PE=2 SV=3 264 308 4.0E-07
sp|Q9SG96|ATL72_ARATH RING-H2 finger protein ATL72 OS=Arabidopsis thaliana GN=ATL72 PE=2 SV=1 266 320 4.0E-07
sp|Q5NCP0|RNF43_MOUSE E3 ubiquitin-protein ligase RNF43 OS=Mus musculus GN=Rnf43 PE=2 SV=1 265 307 4.0E-07
sp|Q4R6Y5|ZNRF4_MACFA Zinc/RING finger protein 4 OS=Macaca fascicularis GN=ZNRF4 PE=2 SV=1 264 308 5.0E-07
sp|Q9LQM2|ATL81_ARATH RING-H2 finger protein ATL81 OS=Arabidopsis thaliana GN=ATL81 PE=2 SV=1 264 308 5.0E-07
sp|Q5SPX3|RN215_MOUSE RING finger protein 215 OS=Mus musculus GN=Rnf215 PE=2 SV=1 262 308 5.0E-07
sp|Q9LRB7|EL5_ORYSJ E3 ubiquitin-protein ligase EL5 OS=Oryza sativa subsp. japonica GN=EL5.1 PE=1 SV=1 263 308 6.0E-07
sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 266 310 6.0E-07
sp|Q9Y6U7|RN215_HUMAN RING finger protein 215 OS=Homo sapiens GN=RNF215 PE=3 SV=2 262 308 6.0E-07
sp|Q68DV7|RNF43_HUMAN E3 ubiquitin-protein ligase RNF43 OS=Homo sapiens GN=RNF43 PE=1 SV=1 258 307 7.0E-07
sp|O64762|ATL38_ARATH RING-H2 finger protein ATL38 OS=Arabidopsis thaliana GN=ATL38 PE=2 SV=1 259 346 9.0E-07
sp|P0C041|ATL53_ARATH Putative RING-H2 finger protein ATL53 OS=Arabidopsis thaliana GN=ATL53 PE=3 SV=2 263 314 9.0E-07
sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=1 SV=1 266 310 1.0E-06
sp|Q9LY41|ATL4_ARATH E3 ubiquitin-protein ligase ATL4 OS=Arabidopsis thaliana GN=ATL4 PE=1 SV=1 266 315 1.0E-06
sp|Q8H7N9|ATL31_ORYSJ E3 ubiquitin-protein ligase Os03g0188200 OS=Oryza sativa subsp. japonica GN=Os03g0188200 PE=2 SV=1 266 314 1.0E-06
sp|Q9SZL4|ATL18_ARATH RING-H2 finger protein ATL18 OS=Arabidopsis thaliana GN=ATL18 PE=2 SV=1 266 316 1.0E-06
sp|O22255|ATL64_ARATH RING-H2 finger protein ATL64 OS=Arabidopsis thaliana GN=ATL64 PE=2 SV=1 266 309 2.0E-06
sp|Q9ULT6|ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens GN=ZNRF3 PE=1 SV=3 266 347 2.0E-06
sp|Q9SUS4|RHA1A_ARATH RING-H2 zinc finger protein RHA1a OS=Arabidopsis thaliana GN=RHA1A PE=2 SV=1 262 317 3.0E-06
sp|P0C035|ATL60_ARATH RING-H2 finger protein ATL60 OS=Arabidopsis thaliana GN=ATL60 PE=2 SV=1 235 397 3.0E-06
sp|O22755|ATL44_ARATH RING-H2 finger protein ATL44 OS=Arabidopsis thaliana GN=ATL44 PE=2 SV=1 266 308 3.0E-06
sp|Q9ZT49|ATL45_ARATH RING-H2 finger protein ATL45 OS=Arabidopsis thaliana GN=ATL45 PE=2 SV=1 266 308 4.0E-06
sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=1 SV=1 266 320 4.0E-06
sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 265 308 6.0E-06
sp|P87139|YDM9_SCHPO Uncharacterized RING finger protein C57A7.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.09 PE=1 SV=1 263 316 6.0E-06
sp|A5WWA0|ZNRF3_DANRE E3 ubiquitin-protein ligase ZNRF3 OS=Danio rerio GN=znrf3 PE=1 SV=2 266 349 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 67 89 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10698
MSVASQTLGAAVRLAVRATDSLADSPSATATGIQSPQTSRAAGTNQSNDNTNNNGGGGGNSSPLLFFVALGFGVV
FTNLWIIVGVKYCFRYNARNRARMTNEDGEPITLETVQRPHRRRREKKLMSMDEVNEKFPMMKYKTWVSERAREG
LPTAGGVSVPVSRTNSLGGADGIVPVMSAMSGKEPPSIEVRRPSDDTVKPPPPVVEPKRDSEKVKLEPDQTNGGQ
MSASQEMTELHRAPSDDEVDDDEHIDAALPPECLGAPGDTCAICIDSLEDDDDVRGLTCGHAFHAVCVDPWLTSR
RACCPLCKADYYTPKPRPNAEADPVPSHNPSVDRRSNPPTTFSGRMRAAWLRTRGSTQSPSPGYPSARTRSHGRN
LGLYNSSGTSASSQRTQSTAAAQPNGGGGGMLSSLRRTLQFGRRRNNAQPASRDTSEAAGSEPITPSQLESGSQA
AGTAPQAMTRAVTQ*
Coding >Hirsu2|10698
ATGAGCGTCGCCAGTCAGACCCTGGGCGCGGCCGTCCGTCTCGCTGTCAGGGCCACCGACTCGCTGGCCGACTCT
CCCTCCGCCACCGCCACCGGCATACAAAGCCCCCAGACTTCGCGAGCCGCCGGCACGAACCAGAGCAACGACAAC
ACCAACAACAATGGCGGCGGCGGCGGCAACAGCTCCCCGCTGCTCTTCTTCGTCGCCCTCGGCTTCGGCGTCGTC
TTCACAAACCTATGGATCATCGTCGGCGTCAAGTACTGTTTCCGCTACAATGCACGCAACCGGGCCCGCATGACC
AACGAAGATGGCGAGCCCATCACCCTCGAGACCGTTCAGCGCCCGCATCGGCGACGCCGCGAGAAGAAGCTCATG
TCCATGGACGAGGTCAATGAAAAATTCCCCATGATGAAGTACAAGACCTGGGTCTCGGAGCGGGCCAGGGAAGGC
CTCCCCACCGCCGGCGGCGTCTCCGTCCCGGTCAGTCGGACCAACAGCCTCGGCGGCGCCGACGGCATCGTGCCC
GTCATGTCGGCCATGTCGGGCAAGGAACCGCCCTCGATTGAGGTGCGGCGCCCGTCCGATGACACCGTCAAGCCC
CCGCCGCCCGTCGTAGAGCCCAAGAGAGACAGCGAAAAGGTGAAGCTCGAGCCGGACCAGACCAACGGTGGCCAG
ATGTCGGCCTCGCAGGAGATGACAGAGCTCCATCGCGCGCCGAGCGATGACGAGGTCGACGACGACGAACACATC
GACGCCGCTCTGCCCCCCGAATGCCTCGGCGCCCCGGGCGACACCTGCGCCATCTGCATCGACAGCCTAGAGGAT
GATGACGATGTCCGCGGTTTGACCTGCGGCCACGCCTTTCACGCCGTTTGTGTCGACCCCTGGCTCACCAGCCGC
CGGGCCTGCTGTCCGCTCTGCAAGGCGGATTACTACACGCCCAAGCCGCGGCCGAACGCCGAGGCCGACCCCGTT
CCCTCGCACAACCCCAGCGTCGACCGCCGCAGCAACCCACCCACCACCTTCTCCGGCCGCATGCGCGCGGCTTGG
CTCCGCACTCGCGGCTCCACCCAGTCCCCTTCGCCCGGCTACCCTTCGGCTCGCACGCGGAGCCACGGACGGAAT
CTTGGCCTGTACAACAGCTCGGGGACGTCGGCATCCAGTCAACGAACCCAGTCCACTGCCGCGGCCCAGCCAAAC
GGCGGAGGCGGCGGCATGCTCTCGTCCCTGCGGCGAACCCTGCAGTTCGGTCGCCGGCGGAACAATGCACAGCCG
GCGTCCCGCGACACTTCGGAAGCTGCTGGCAGCGAACCAATCACTCCCTCACAGCTCGAGTCTGGCAGCCAGGCG
GCCGGGACGGCTCCTCAGGCGATGACGCGGGCCGTCACGCAGTAA
Transcript >Hirsu2|10698
ATGAGCGTCGCCAGTCAGACCCTGGGCGCGGCCGTCCGTCTCGCTGTCAGGGCCACCGACTCGCTGGCCGACTCT
CCCTCCGCCACCGCCACCGGCATACAAAGCCCCCAGACTTCGCGAGCCGCCGGCACGAACCAGAGCAACGACAAC
ACCAACAACAATGGCGGCGGCGGCGGCAACAGCTCCCCGCTGCTCTTCTTCGTCGCCCTCGGCTTCGGCGTCGTC
TTCACAAACCTATGGATCATCGTCGGCGTCAAGTACTGTTTCCGCTACAATGCACGCAACCGGGCCCGCATGACC
AACGAAGATGGCGAGCCCATCACCCTCGAGACCGTTCAGCGCCCGCATCGGCGACGCCGCGAGAAGAAGCTCATG
TCCATGGACGAGGTCAATGAAAAATTCCCCATGATGAAGTACAAGACCTGGGTCTCGGAGCGGGCCAGGGAAGGC
CTCCCCACCGCCGGCGGCGTCTCCGTCCCGGTCAGTCGGACCAACAGCCTCGGCGGCGCCGACGGCATCGTGCCC
GTCATGTCGGCCATGTCGGGCAAGGAACCGCCCTCGATTGAGGTGCGGCGCCCGTCCGATGACACCGTCAAGCCC
CCGCCGCCCGTCGTAGAGCCCAAGAGAGACAGCGAAAAGGTGAAGCTCGAGCCGGACCAGACCAACGGTGGCCAG
ATGTCGGCCTCGCAGGAGATGACAGAGCTCCATCGCGCGCCGAGCGATGACGAGGTCGACGACGACGAACACATC
GACGCCGCTCTGCCCCCCGAATGCCTCGGCGCCCCGGGCGACACCTGCGCCATCTGCATCGACAGCCTAGAGGAT
GATGACGATGTCCGCGGTTTGACCTGCGGCCACGCCTTTCACGCCGTTTGTGTCGACCCCTGGCTCACCAGCCGC
CGGGCCTGCTGTCCGCTCTGCAAGGCGGATTACTACACGCCCAAGCCGCGGCCGAACGCCGAGGCCGACCCCGTT
CCCTCGCACAACCCCAGCGTCGACCGCCGCAGCAACCCACCCACCACCTTCTCCGGCCGCATGCGCGCGGCTTGG
CTCCGCACTCGCGGCTCCACCCAGTCCCCTTCGCCCGGCTACCCTTCGGCTCGCACGCGGAGCCACGGACGGAAT
CTTGGCCTGTACAACAGCTCGGGGACGTCGGCATCCAGTCAACGAACCCAGTCCACTGCCGCGGCCCAGCCAAAC
GGCGGAGGCGGCGGCATGCTCTCGTCCCTGCGGCGAACCCTGCAGTTCGGTCGCCGGCGGAACAATGCACAGCCG
GCGTCCCGCGACACTTCGGAAGCTGCTGGCAGCGAACCAATCACTCCCTCACAGCTCGAGTCTGGCAGCCAGGCG
GCCGGGACGGCTCCTCAGGCGATGACGCGGGCCGTCACGCAGTAA
Gene >Hirsu2|10698
ATGAGCGTCGCCAGTCAGACCCTGGGCGCGGCCGTCCGTCTCGCTGTCAGGGCCACCGACTCGCTGGCCGACTCT
CCCTCCGCCACCGCCACCGGCATACAAAGCCCCCAGACTTCGCGAGCCGCCGGCACGAACCAGAGCAACGACAAC
ACCAACAACAATGGCGGCGGCGGCGGCAACAGCTCCCCGCTGCTCTTCTTCGTCGCCCTCGGCTTCGGCGTCGTC
TTCACAAACCTATGGTAAGGAAGCATGTTTGGATTCACCACGCCTGTGCCTGTTCCCGCCCCTTCCCGGCGGCAT
CCGGAAATCATGACGCATGGTCGCCGAGATGCCGTCTCCGCTTCCTGTCCCCGGACACGGCGCTTACCATGACGT
CGCAGGATCATCGTCGGCGTCAAGTACTGTTTCCGCTACAATGCACGCAACCGGGCCCGCATGACCAACGAAGAT
GGCGAGCCCATCACCCTCGAGACCGTTCAGCGCCCGCATCGGCGACGCCGCGAGAAGAAGCTCATGTCCATGGAC
GAGGTCAATGAAAAATTCCCCATGATGAAGTACAAGACCTGGGTCTCGGAGCGGGCCAGGGAAGGCCTCCCCACC
GCCGGCGGCGTCTCCGTCCCGGTCAGTCGGACCAACAGCCTCGGCGGCGCCGACGGCATCGTGCCCGTCATGTCG
GCCATGTCGGGCAAGGAACCGCCCTCGATTGAGGTGCGGCGCCCGTCCGATGACACCGTCAAGCCCCCGCCGCCC
GTCGTAGAGCCCAAGAGAGACAGCGAAAAGGTGAAGCTCGAGCCGGACCAGACCAACGGTGGCCAGATGTCGGCC
TCGCAGGAGATGACAGAGCTCCATCGCGCGCCGAGCGATGACGAGGTCGACGACGACGAACACATCGACGCCGCT
CTGCCCCCCGAATGCCTCGGCGCCCCGGGCGACACCTGCGCCATCTGCATCGACAGCCTAGAGGATGATGACGAT
GTCCGCGGTTTGACCTGCGGCCACGCCTTTCACGCCGTTTGTGTCGACCCCTGGCTCACCAGCCGCCGGGCCTGC
TGTCCGCTCTGCAAGGCGGATTACTACACGCCCAAGCCGCGGCCGAACGCCGAGGCCGACCCCGTTCCCTCGCAC
AACCCCAGCGTCGACCGCCGCAGCAACCCACCCACCACCTTCTCCGGCCGCATGCGCGCGGCTTGGCTCCGCACT
CGCGGCTCCACCCAGTCCCCTTCGCCCGGCTACCCTTCGGCTCGCACGCGGAGCCACGGACGGAATCTTGGCCTG
TACAACAGCTCGGGGACGTCGGCATCCAGTCAACGAACCCAGTCCACTGCCGCGGCCCAGCCAAACGGCGGAGGC
GGCGGCATGCTCTCGTCCCTGCGGCGAACCCTGCAGTTCGGTCGCCGGCGGAACAATGCACAGCCGGCGTCCCGC
GACACTTCGGAAGCTGCTGGCAGCGAACCAATCACTCCCTCACAGCTCGAGTCTGGCAGCCAGGCGGCCGGGACG
GCTCCTCAGGCGATGACGCGGGCCGTCACGCAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail