Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10687
Gene name
LocationContig_89:16062..19499
Strand-
Gene length (bp)3437
Transcript length (bp)3270
Coding sequence length (bp)3270
Protein length (aa) 1090

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase 1.2E-62 719 985
PF05088 Bac_GDH Bacterial NAD-glutamate dehydrogenase 1.2E-13 438 649

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P00365|DHE2_NEUCR NAD-specific glutamate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gdh-1 PE=1 SV=4 38 1085 0.0E+00
sp|Q9USN5|GDH2_SCHPO Probable NAD-specific glutamate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gdh2 PE=3 SV=1 24 1084 0.0E+00
sp|Q54VI3|GLUD2_DICDI Glutamate dehydrogenase 2 OS=Dictyostelium discoideum GN=glud2 PE=1 SV=2 96 1077 0.0E+00
sp|P33327|DHE2_YEAST NAD-specific glutamate dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDH2 PE=1 SV=1 81 1086 0.0E+00
sp|O53203|DHE2_MYCTU NAD-specific glutamate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gdh PE=1 SV=1 434 927 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P00365|DHE2_NEUCR NAD-specific glutamate dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gdh-1 PE=1 SV=4 38 1085 0.0E+00
sp|Q9USN5|GDH2_SCHPO Probable NAD-specific glutamate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gdh2 PE=3 SV=1 24 1084 0.0E+00
sp|Q54VI3|GLUD2_DICDI Glutamate dehydrogenase 2 OS=Dictyostelium discoideum GN=glud2 PE=1 SV=2 96 1077 0.0E+00
sp|P33327|DHE2_YEAST NAD-specific glutamate dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDH2 PE=1 SV=1 81 1086 0.0E+00
sp|O53203|DHE2_MYCTU NAD-specific glutamate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gdh PE=1 SV=1 434 927 2.0E-12
sp|A0R1C2|DHE2_MYCS2 NAD-specific glutamate dehydrogenase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=gdh PE=1 SV=1 520 818 1.0E-11
sp|Q9HZE0|DHE2_PSEAE NAD-specific glutamate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gdhB PE=1 SV=1 529 1065 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0019551 glutamate catabolic process to 2-oxoglutarate Yes
GO:0006520 cellular amino acid metabolic process Yes
GO:0055114 oxidation-reduction process Yes
GO:0004352 glutamate dehydrogenase (NAD+) activity Yes
GO:0006807 nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0046395 carboxylic acid catabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0016639 oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor No
GO:0071704 organic substance metabolic process No
GO:0006536 glutamate metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0006103 2-oxoglutarate metabolic process No
GO:0044238 primary metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0008152 metabolic process No
GO:0044248 cellular catabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:1901605 alpha-amino acid metabolic process No
GO:1901575 organic substance catabolic process No
GO:0043649 dicarboxylic acid catabolic process No
GO:0006106 fumarate metabolic process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0051186 cofactor metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901606 alpha-amino acid catabolic process No
GO:0006538 glutamate catabolic process No
GO:0043648 dicarboxylic acid metabolic process No
GO:0009065 glutamine family amino acid catabolic process No
GO:0004353 glutamate dehydrogenase [NAD(P)+] activity No
GO:0016054 organic acid catabolic process No
GO:0009056 catabolic process No
GO:0003824 catalytic activity No
GO:0009064 glutamine family amino acid metabolic process No
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors No
GO:0006082 organic acid metabolic process No
GO:0044282 small molecule catabolic process No
GO:0009063 cellular amino acid catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10687
MFRVDAPQTDLASQDHFPDYVDQLDDTQRFSTMGSITPKPRPLVSIQSSEESSRRPSPQPLHFSVPLVSHPNANG
HRTLRSATVGYVAPEFAGKLEQMKSVKGIILQAGWIPEPLVEEQIRWFYEQLGIDDVYFRIETPDVIASQITSLY
AAKVAAFSREDKREEIRLDMEANDHAIYIDTSEPGKANVGGPRYESRLEAKYLDHQGRTKYRVETFRSPAAIGAS
PTSKATLRCYFVYQCQFKQSLETTDPKETNIELISDTGFWQKATDNTKQIYQEVIELAVNRTGPVIEVFDIEGSP
EKRLVIAFRTRTARGMFSALSDLYHYYGITSSRKYVEQFSNGITIMSIYLRPAMHLEGYFPPIDDSINQIAKEIS
LLYCLPQNKFHSLFAVGDLSLQEAVYAHSAWVFVQHFLNRLGPEYASLSQILDPADTAQAALLSRLKRRLRTETF
TPDYILEIIQTYPGLVRSLYASFANVHLGSSADSSAPHTVPPTPVVDVLSDEKLKETISKTVANEHDEMVMTAFR
VFNNAILKTNYFTPTKVALSFRLDPSFLPDVEYPRRLYGMFLVIGAESRGFHLRFRDISRGGIRIVKSRSKEAYG
INARNLFDENYGLANTQQRKNKDIPEGGSKGVILLDPKQQDKAREAFEKYIDSILDLLLPAVSPGIKNKLVDLYG
KEEILFMGPDENTADLVDWATEHARIRGAPWWKSFFTGKSPKLGGIPHDKYGMTTLSVREYVKGIYRKLNLDPSR
VRKMQTGGPDGDLGSNEILLGNEKWTAIVDGSGVLADPNGLDREELLRLAKKRVMISEYDMSKVSKDGYRVLCDD
NNVTLPSGETVTNGTSFRNTYHLRDTGMTDAFVPCGGRPESIDLISVNRLIRDGKTTIPYIVEGANLFITQDAKL
RLEAAGCILYKDASANKGGVTSSSLEVLASLSFDDKGFVQNMCCDAETGEAPQFYNDYVREVQAKIQENARLEFE
AIWREHEATGIPRSILSDKLSLAITDLDEELQKSDLWANERIRYDVLRDALPGLLLKKIGLETIISRVPDNYLRS
IFGSYLASRFVYEFGSEPSQFAFFDFMSKRMAKMNALMG*
Coding >Hirsu2|10687
ATGTTCCGTGTCGACGCCCCTCAGACTGACCTGGCGTCGCAGGATCACTTCCCAGACTACGTTGACCAGCTCGAC
GATACACAAAGGTTTTCCACCATGGGGTCAATCACGCCCAAACCAAGGCCGCTGGTCAGCATCCAGTCGTCTGAG
GAGTCCAGCCGTCGCCCCTCGCCGCAGCCCCTACATTTCAGTGTCCCCCTCGTGTCACATCCAAACGCCAATGGC
CACCGGACTCTGCGGTCAGCCACAGTCGGCTACGTGGCTCCCGAGTTTGCCGGAAAGCTGGAGCAGATGAAATCT
GTCAAGGGCATCATCCTGCAGGCTGGATGGATCCCCGAACCGCTTGTTGAGGAGCAGATCCGCTGGTTCTACGAG
CAGCTGGGCATTGACGATGTCTACTTCCGTATTGAGACGCCGGACGTCATTGCCAGCCAAATCACGTCGCTCTAC
GCCGCCAAGGTGGCCGCCTTCTCTCGCGAGGACAAGCGAGAGGAGATCCGCCTGGACATGGAGGCAAATGACCAC
GCCATCTACATTGACACCAGCGAGCCGGGCAAGGCCAATGTCGGCGGCCCGAGATACGAGTCGCGCCTTGAGGCC
AAGTACCTCGACCACCAGGGCAGGACCAAATATCGGGTCGAGACCTTCCGCTCGCCGGCTGCCATCGGCGCCAGC
CCTACCTCCAAGGCTACTCTTCGCTGCTACTTCGTCTACCAGTGCCAGTTCAAGCAGAGCCTCGAGACCACGGAC
CCTAAGGAGACCAACATCGAGCTCATCTCTGACACGGGCTTCTGGCAAAAGGCCACGGACAACACCAAGCAGATC
TACCAGGAAGTCATTGAACTGGCGGTCAATAGGACTGGCCCCGTCATTGAAGTCTTCGACATCGAGGGATCCCCA
GAGAAGCGTCTGGTCATTGCCTTCCGAACCCGCACCGCCCGCGGCATGTTCTCGGCCCTGAGCGACCTCTACCAC
TACTACGGCATCACCAGCTCGAGGAAATATGTGGAGCAGTTCTCCAACGGCATCACAATCATGAGCATCTATCTC
CGGCCTGCCATGCATCTCGAGGGCTACTTCCCACCCATCGATGACTCCATCAACCAGATCGCCAAGGAGATTTCT
CTCCTTTACTGCCTGCCGCAGAACAAGTTCCACAGCCTCTTTGCCGTTGGAGACTTGAGCCTGCAGGAGGCCGTA
TACGCCCACTCTGCCTGGGTCTTCGTGCAGCACTTCCTCAACCGGCTGGGTCCCGAGTATGCCTCCCTATCACAG
ATTCTCGACCCGGCCGACACGGCTCAGGCTGCCCTACTGTCACGCTTGAAACGGCGTCTGAGGACGGAGACGTTC
ACGCCCGACTACATCCTGGAGATCATCCAGACGTACCCTGGCCTCGTGAGGTCTTTGTATGCGTCCTTCGCCAAC
GTCCACCTGGGCAGCAGCGCCGATTCCAGCGCACCGCATACCGTGCCGCCAACTCCCGTCGTCGACGTACTGTCG
GACGAGAAGCTTAAGGAGACTATTTCCAAGACGGTGGCCAACGAGCACGACGAGATGGTCATGACGGCTTTTAGG
GTTTTCAATAATGCCATTCTCAAGACCAACTACTTCACCCCTACCAAGGTCGCCCTCAGTTTCCGTTTGGACCCA
TCCTTCCTGCCAGATGTCGAGTACCCTCGCCGTCTCTACGGTATGTTCCTTGTGATTGGGGCTGAGTCGCGAGGA
TTTCATTTGCGCTTCCGCGACATCTCGCGCGGCGGCATCCGCATCGTCAAGTCTCGGAGCAAAGAAGCCTATGGC
ATCAACGCGCGCAACCTATTCGACGAGAACTACGGACTGGCCAACACACAGCAACGCAAGAACAAGGACATCCCT
GAAGGCGGCTCCAAGGGTGTCATTCTTCTTGATCCCAAGCAGCAAGACAAGGCCCGAGAAGCTTTCGAGAAGTAC
ATTGACAGCATTCTCGACCTCCTGCTGCCGGCCGTCAGCCCGGGTATCAAGAATAAGCTGGTGGATCTGTACGGC
AAGGAGGAGATTCTCTTCATGGGCCCGGACGAGAACACGGCCGATCTAGTGGACTGGGCCACGGAGCACGCAAGG
ATCCGTGGCGCTCCGTGGTGGAAGTCGTTCTTCACCGGCAAGTCGCCGAAGCTGGGCGGCATTCCCCACGACAAG
TACGGCATGACGACGCTGTCAGTGCGTGAGTACGTCAAGGGAATTTACAGGAAGCTTAACCTGGATCCGTCCAGA
GTCAGGAAGATGCAGACCGGTGGGCCCGACGGCGACCTGGGAAGCAACGAGATATTGCTCGGCAACGAGAAGTGG
ACGGCCATTGTCGACGGCTCCGGCGTGCTGGCCGATCCCAACGGCCTCGACCGGGAGGAACTGCTTCGATTGGCT
AAGAAGCGTGTCATGATCAGCGAGTATGACATGTCCAAGGTATCCAAGGATGGCTACCGCGTCCTGTGCGACGAC
AACAACGTGACCCTCCCCAGCGGCGAGACTGTCACGAACGGCACGTCCTTCCGGAACACGTACCATTTGCGTGAC
ACGGGAATGACGGATGCCTTCGTGCCTTGCGGCGGCCGCCCCGAGTCCATCGACCTCATCTCCGTCAACAGGCTG
ATCAGGGACGGCAAGACGACGATTCCGTACATCGTGGAGGGCGCCAATCTGTTCATCACGCAGGACGCTAAGCTC
CGCCTCGAGGCTGCCGGCTGCATATTGTACAAGGACGCGTCGGCGAACAAGGGTGGAGTTACGTCGTCGTCGCTG
GAAGTGCTGGCCTCCCTGTCGTTTGACGACAAGGGGTTCGTGCAAAATATGTGCTGCGATGCCGAGACCGGAGAG
GCGCCCCAGTTCTACAACGACTACGTCCGTGAGGTTCAAGCCAAGATTCAAGAGAATGCCAGGCTCGAGTTCGAG
GCCATCTGGCGCGAGCACGAGGCCACCGGCATTCCTCGGTCCATCCTTTCGGACAAGCTTTCGCTGGCCATCACA
GACCTGGACGAGGAGCTGCAGAAATCGGATCTCTGGGCCAACGAAAGGATTCGATACGACGTGCTCCGGGACGCG
CTCCCCGGCCTGCTCCTCAAGAAGATTGGGCTGGAAACGATCATCTCTCGGGTGCCCGACAACTATCTGCGGAGC
ATCTTCGGCAGTTACCTGGCCAGTCGGTTCGTCTACGAGTTTGGTAGCGAGCCCAGCCAGTTCGCCTTCTTTGAC
TTCATGTCGAAAAGGATGGCTAAGATGAATGCATTGATGGGTTGA
Transcript >Hirsu2|10687
ATGTTCCGTGTCGACGCCCCTCAGACTGACCTGGCGTCGCAGGATCACTTCCCAGACTACGTTGACCAGCTCGAC
GATACACAAAGGTTTTCCACCATGGGGTCAATCACGCCCAAACCAAGGCCGCTGGTCAGCATCCAGTCGTCTGAG
GAGTCCAGCCGTCGCCCCTCGCCGCAGCCCCTACATTTCAGTGTCCCCCTCGTGTCACATCCAAACGCCAATGGC
CACCGGACTCTGCGGTCAGCCACAGTCGGCTACGTGGCTCCCGAGTTTGCCGGAAAGCTGGAGCAGATGAAATCT
GTCAAGGGCATCATCCTGCAGGCTGGATGGATCCCCGAACCGCTTGTTGAGGAGCAGATCCGCTGGTTCTACGAG
CAGCTGGGCATTGACGATGTCTACTTCCGTATTGAGACGCCGGACGTCATTGCCAGCCAAATCACGTCGCTCTAC
GCCGCCAAGGTGGCCGCCTTCTCTCGCGAGGACAAGCGAGAGGAGATCCGCCTGGACATGGAGGCAAATGACCAC
GCCATCTACATTGACACCAGCGAGCCGGGCAAGGCCAATGTCGGCGGCCCGAGATACGAGTCGCGCCTTGAGGCC
AAGTACCTCGACCACCAGGGCAGGACCAAATATCGGGTCGAGACCTTCCGCTCGCCGGCTGCCATCGGCGCCAGC
CCTACCTCCAAGGCTACTCTTCGCTGCTACTTCGTCTACCAGTGCCAGTTCAAGCAGAGCCTCGAGACCACGGAC
CCTAAGGAGACCAACATCGAGCTCATCTCTGACACGGGCTTCTGGCAAAAGGCCACGGACAACACCAAGCAGATC
TACCAGGAAGTCATTGAACTGGCGGTCAATAGGACTGGCCCCGTCATTGAAGTCTTCGACATCGAGGGATCCCCA
GAGAAGCGTCTGGTCATTGCCTTCCGAACCCGCACCGCCCGCGGCATGTTCTCGGCCCTGAGCGACCTCTACCAC
TACTACGGCATCACCAGCTCGAGGAAATATGTGGAGCAGTTCTCCAACGGCATCACAATCATGAGCATCTATCTC
CGGCCTGCCATGCATCTCGAGGGCTACTTCCCACCCATCGATGACTCCATCAACCAGATCGCCAAGGAGATTTCT
CTCCTTTACTGCCTGCCGCAGAACAAGTTCCACAGCCTCTTTGCCGTTGGAGACTTGAGCCTGCAGGAGGCCGTA
TACGCCCACTCTGCCTGGGTCTTCGTGCAGCACTTCCTCAACCGGCTGGGTCCCGAGTATGCCTCCCTATCACAG
ATTCTCGACCCGGCCGACACGGCTCAGGCTGCCCTACTGTCACGCTTGAAACGGCGTCTGAGGACGGAGACGTTC
ACGCCCGACTACATCCTGGAGATCATCCAGACGTACCCTGGCCTCGTGAGGTCTTTGTATGCGTCCTTCGCCAAC
GTCCACCTGGGCAGCAGCGCCGATTCCAGCGCACCGCATACCGTGCCGCCAACTCCCGTCGTCGACGTACTGTCG
GACGAGAAGCTTAAGGAGACTATTTCCAAGACGGTGGCCAACGAGCACGACGAGATGGTCATGACGGCTTTTAGG
GTTTTCAATAATGCCATTCTCAAGACCAACTACTTCACCCCTACCAAGGTCGCCCTCAGTTTCCGTTTGGACCCA
TCCTTCCTGCCAGATGTCGAGTACCCTCGCCGTCTCTACGGTATGTTCCTTGTGATTGGGGCTGAGTCGCGAGGA
TTTCATTTGCGCTTCCGCGACATCTCGCGCGGCGGCATCCGCATCGTCAAGTCTCGGAGCAAAGAAGCCTATGGC
ATCAACGCGCGCAACCTATTCGACGAGAACTACGGACTGGCCAACACACAGCAACGCAAGAACAAGGACATCCCT
GAAGGCGGCTCCAAGGGTGTCATTCTTCTTGATCCCAAGCAGCAAGACAAGGCCCGAGAAGCTTTCGAGAAGTAC
ATTGACAGCATTCTCGACCTCCTGCTGCCGGCCGTCAGCCCGGGTATCAAGAATAAGCTGGTGGATCTGTACGGC
AAGGAGGAGATTCTCTTCATGGGCCCGGACGAGAACACGGCCGATCTAGTGGACTGGGCCACGGAGCACGCAAGG
ATCCGTGGCGCTCCGTGGTGGAAGTCGTTCTTCACCGGCAAGTCGCCGAAGCTGGGCGGCATTCCCCACGACAAG
TACGGCATGACGACGCTGTCAGTGCGTGAGTACGTCAAGGGAATTTACAGGAAGCTTAACCTGGATCCGTCCAGA
GTCAGGAAGATGCAGACCGGTGGGCCCGACGGCGACCTGGGAAGCAACGAGATATTGCTCGGCAACGAGAAGTGG
ACGGCCATTGTCGACGGCTCCGGCGTGCTGGCCGATCCCAACGGCCTCGACCGGGAGGAACTGCTTCGATTGGCT
AAGAAGCGTGTCATGATCAGCGAGTATGACATGTCCAAGGTATCCAAGGATGGCTACCGCGTCCTGTGCGACGAC
AACAACGTGACCCTCCCCAGCGGCGAGACTGTCACGAACGGCACGTCCTTCCGGAACACGTACCATTTGCGTGAC
ACGGGAATGACGGATGCCTTCGTGCCTTGCGGCGGCCGCCCCGAGTCCATCGACCTCATCTCCGTCAACAGGCTG
ATCAGGGACGGCAAGACGACGATTCCGTACATCGTGGAGGGCGCCAATCTGTTCATCACGCAGGACGCTAAGCTC
CGCCTCGAGGCTGCCGGCTGCATATTGTACAAGGACGCGTCGGCGAACAAGGGTGGAGTTACGTCGTCGTCGCTG
GAAGTGCTGGCCTCCCTGTCGTTTGACGACAAGGGGTTCGTGCAAAATATGTGCTGCGATGCCGAGACCGGAGAG
GCGCCCCAGTTCTACAACGACTACGTCCGTGAGGTTCAAGCCAAGATTCAAGAGAATGCCAGGCTCGAGTTCGAG
GCCATCTGGCGCGAGCACGAGGCCACCGGCATTCCTCGGTCCATCCTTTCGGACAAGCTTTCGCTGGCCATCACA
GACCTGGACGAGGAGCTGCAGAAATCGGATCTCTGGGCCAACGAAAGGATTCGATACGACGTGCTCCGGGACGCG
CTCCCCGGCCTGCTCCTCAAGAAGATTGGGCTGGAAACGATCATCTCTCGGGTGCCCGACAACTATCTGCGGAGC
ATCTTCGGCAGTTACCTGGCCAGTCGGTTCGTCTACGAGTTTGGTAGCGAGCCCAGCCAGTTCGCCTTCTTTGAC
TTCATGTCGAAAAGGATGGCTAAGATGAATGCATTGATGGGTTGA
Gene >Hirsu2|10687
ATGTTCCGTGTCGACGCCCCTCAGACTGACCTGGCGTCGCAGGATCACTTCCCAGACTACGTTGACCAGCTCGAC
GATACACAAAGGTTTTCCACCATGGGGTCAATCACGCCCAAACCAAGGCCGCTGGTCAGCATCCAGTCGTCTGAG
GAGTCCAGCCGTCGCCCCTCGCCGCAGCCCCTACATTTCAGTGTCCCCCTCGTGTCACATCCAAACGCCAATGGC
CACCGGACTCTGCGGTCAGCCACAGTCGGCTACGTGGCTCCCGAGTTTGCCGGAAAGCTGGAGCAGATGAAATCT
GGTGAGCATCTCTCCTGTTGGAACAAGCACTGGCTTCTCCGCCCGCCGTCCCCTTGCACGTCGAGGCACTGCTGA
CTCGGCTTCGTGCGCACTGCAGTCAAGGGCATCATCCTGCAGGCTGGATGGATCCCCGAACCGCTTGTTGAGGAG
CAGATCCGCTGGTTCTACGAGCAGCTGGGCATTGACGATGTCTACTTCCGTATTGAGACGCCGGACGTCATTGCC
AGCCAAATCACGTCGCTCTACGCCGCCAAGGTGGCCGCCTTCTCTCGCGAGGACAAGCGAGAGGAGATCCGCCTG
GACATGGAGGCAAATGACCACGCCATCTACATTGACACCAGCGAGCCGGGCAAGGCCAATGTCGGCGGCCCGAGA
TACGAGTCGCGCCTTGAGGCCAAGTACCTCGACCACCAGGGCAGGACCAAATATCGGGTCGAGACCTTCCGCTCG
CCGGCTGCCATCGGCGCCAGCCCTACCTCCAAGGCTACTCTTCGCTGCTACTTCGTCTACCAGTGCCAGTTCAAG
CAGAGCCTCGAGACCACGGACCCTAAGGAGACCAACATCGAGCTCATCTCTGACACGGGCTTCTGGCAAAAGGCC
ACGGACAACACCAAGCAGATCTACCAGGAAGTCATTGAACTGGCGGTCAATAGGACTGGCCCCGTCATTGAAGTC
TTCGACATCGAGGGATCCCCAGAGAAGCGTCTGGTCATTGCCTTCCGAACCCGCACCGCCCGCGGCATGTTCTCG
GCCCTGAGCGACCTCTACCACTACTACGGCATCACCAGCTCGAGGAAATATGTGGAGCAGTTCTCCAACGGCATC
ACAATCATGAGCATCTATCTCCGGCCTGCCATGCATCTCGAGGGCTACTTCCCACCCATCGATGACTCCATCAAC
CAGATCGCCAAGGAGATTTCTCTCCTTTACTGCCTGCCGCAGAACAAGTTCCACAGCCTCTTTGCCGTTGGAGAC
TTGAGCCTGCAGGAGGCCGTATACGCCCACTCTGCCTGGGTCTTCGTGCAGCACTTCCTCAACCGGCTGGGTCCC
GAGTATGCCTCCCTATCACAGATTCTCGACCCGGCCGACACGGCTCAGGCTGCCCTACTGTCACGCTTGAAACGG
CGTCTGAGGACGGAGACGTTCACGCCCGACTACATCCTGGAGATCATCCAGACGTACCCTGGCCTCGTGAGGTCT
TTGTATGCGTCCTTCGCCAACGTCCACCTGGGCAGCAGCGCCGATTCCAGCGCACCGCATACCGTGCCGCCAACT
CCCGTCGTCGACGTACTGTCGGACGAGAAGCTTAAGGAGACTATTTCCAAGACGGTGGCCAACGAGCACGACGAG
ATGGTCATGACGGCTTTTAGGGTTTTCAATAATGCCATTCTCAAGACCAACTACTTCACCCCTACCAAGGTCGCC
CTCAGTTTCCGTTTGGACCCATCCTTCCTGCCAGATGTCGAGTACCCTCGCCGTCTCTACGGTATGTTCCTTGTG
ATTGGGGCTGAGTCGCGAGGATTTCATTTGCGCTTCCGCGACATCTCGCGCGGCGGCATCCGCATCGTCAAGTCT
CGGAGCAAAGAAGCCTATGGCATCAACGCGCGCAACCTATTCGACGAGAACTACGGACTGGCCAACACACAGCAA
CGCAAGAACAAGGACATCCCTGAAGGCGGCTCCAAGGGTGTCATTCTTCTTGATCCCAAGCAGCAAGACAAGGCC
CGAGAAGCTTTCGAGAAGTACATTGACAGCATTCTCGACCTCCTGCTGCCGGCCGTCAGCCCGGGTATCAAGAAT
AAGCTGGTGGATCTGTACGGCAAGGAGGAGATTCTCTTCATGGGCCCGGACGAGAACACGGCCGATCTAGTGGAC
TGGGCCACGGAGCACGCAAGGATCCGTGGCGCTCCGTGGTGGAAGTCGTTCTTCACCGGCAAGTCGCCGAAGCTG
GGCGGCATTCCCCACGACAAGTACGGCATGACGACGCTGTCAGTGCGTGAGTACGTCAAGGGAATTTACAGGAAG
CTTAACCTGGATCCGTCCAGAGTCAGGAAGATGCAGACCGGTGGGCCCGACGGCGACCTGGGAAGCAACGAGATA
TTGCTCGGCAACGAGAAGTGGACGGCCATTGTCGACGGCTCCGGCGTGCTGGCCGATCCCAACGGCCTCGACCGG
GAGGAACTGCTTCGATTGGCTAAGAAGCGTGTCATGATCAGCGAGTATGACATGTCCAAGGTATCCAAGGATGGC
TACCGCGTCCTGTGCGACGACAACAACGTGACCCTCCCCAGCGGCGAGACTGTCACGAACGGCACGTCCTTCCGG
AACACGTACCATTTGCGTGACACGGGAATGACGGATGCCTTCGTGCCTTGCGGCGGCCGCCCCGAGTCCATCGAC
CTCATCTCCGTCAACAGGCTGATCAGGGACGGCAAGACGACGATTCCGTACATCGTGGAGGGCGCCAATCTGTTC
ATCACGCAGGACGCTAAGCTCCGCCTCGAGGCTGCCGGCTGCATATTGTACAAGGACGCGTCGGCGAACAAGGGT
GGAGTTACGTCGTCGTCGCTGGAAGTGCTGGCCTCCCTGTCGTTTGACGACAAGGGGTTCGTGCAAAATATGTGC
TGCGATGCCGAGACCGGAGAGGCGCCCCAGTTCTACAACGACTACGTCCGTGAGGTTCAAGCCAAGATTCAAGAG
AATGCCAGGCTCGAGTTCGAGGCCATCTGGCGCGAGCACGAGGCCACCGGCATTCCTCGGTCCATCCTTTCGGAC
AAGCTTTCGCTGGCCATCACAGACCTGGACGAGGAGCTGCAGAAATCGGATCTCTGGGCCAACGAAAGGATTCGA
TACGACGTGCTCCGGGACGCGCTCCCCGGCCTGCTCCTCAAGAAGATTGGGCTGGAAACGATCATCTCTCGGGTG
CCCGACAACTATCTGCGGAGCATCTTCGGCAGTTACCTGGCCAGTCGGTTCGTCTACGAGTTTGGTAGCGAGCCC
AGCCAGTTCGCCTTCTTTGACTTGTGAGTAGCCCGTAGGCGTTACCGGTGACGGAAGTGAAACCCTGCTGACCTG
TTATCTTTCAACCTTTCAGCATGTCGAAAAGGATGGCTAAGATGAATGCATTGATGGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail