Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10669
Gene name
LocationContig_887:2671..3619
Strand-
Gene length (bp)948
Transcript length (bp)858
Coding sequence length (bp)858
Protein length (aa) 286

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02728 Cu_amine_oxidN3 Copper amine oxidase, N3 domain 1.7E-21 96 197
PF01179 Cu_amine_oxid Copper amine oxidase, enzyme domain 7.1E-21 224 285
PF02727 Cu_amine_oxidN2 Copper amine oxidase, N2 domain 6.0E-12 5 89

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7F2|CAO1_SCHPO Copper amine oxidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cao1 PE=1 SV=1 6 285 3.0E-92
sp|P12807|AMO_PICAN Peroxisomal primary amine oxidase OS=Pichia angusta GN=AMO PE=1 SV=1 5 285 1.0E-90
sp|O42890|CAO2_SCHPO Copper amine oxidase-like protein cao2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cao2 PE=3 SV=1 6 285 2.0E-73
sp|Q07123|AMO2_ARTS1 Copper methylamine oxidase OS=Arthrobacter sp. (strain P1) GN=maoII PE=1 SV=1 5 285 2.0E-39
sp|Q07121|AMO1_ARTS1 Primary amine oxidase OS=Arthrobacter sp. (strain P1) GN=maoI PE=1 SV=1 5 285 2.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7F2|CAO1_SCHPO Copper amine oxidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cao1 PE=1 SV=1 6 285 3.0E-92
sp|P12807|AMO_PICAN Peroxisomal primary amine oxidase OS=Pichia angusta GN=AMO PE=1 SV=1 5 285 1.0E-90
sp|O42890|CAO2_SCHPO Copper amine oxidase-like protein cao2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cao2 PE=3 SV=1 6 285 2.0E-73
sp|Q07123|AMO2_ARTS1 Copper methylamine oxidase OS=Arthrobacter sp. (strain P1) GN=maoII PE=1 SV=1 5 285 2.0E-39
sp|Q07121|AMO1_ARTS1 Primary amine oxidase OS=Arthrobacter sp. (strain P1) GN=maoI PE=1 SV=1 5 285 2.0E-39
sp|P49250|AMO_ENTAE Primary amine oxidase OS=Enterobacter aerogenes GN=maoA PE=1 SV=1 4 285 9.0E-33
sp|P80695|AMO_KLEOK Primary amine oxidase OS=Klebsiella oxytoca (strain ATCC 8724 / DSM 4798 / JCM 20051 / NBRC 3318 / NRRL B-199 / KCTC 1686) GN=maoA PE=1 SV=2 4 285 5.0E-28
sp|Q12556|AMO1_ASPNG Copper amine oxidase 1 OS=Aspergillus niger GN=AO-I PE=1 SV=2 4 285 7.0E-28
sp|P46883|AMO_ECOLI Primary amine oxidase OS=Escherichia coli (strain K12) GN=tynA PE=1 SV=1 4 285 3.0E-27
sp|Q59118|AMOH_ARTGO Histamine oxidase OS=Arthrobacter globiformis PE=1 SV=3 2 285 4.0E-22
sp|P46881|PAOX_ARTGO Phenylethylamine oxidase OS=Arthrobacter globiformis PE=1 SV=1 129 285 6.0E-16
sp|Q8H1H9|AMO_ARATH Primary amine oxidase OS=Arabidopsis thaliana GN=At1g62810 PE=2 SV=1 5 285 9.0E-14
sp|Q43077|AMO_PEA Primary amine oxidase OS=Pisum sativum PE=1 SV=1 5 285 6.0E-12
sp|P49252|AMO_LENCU Primary amine oxidase (Fragment) OS=Lens culinaris PE=1 SV=3 5 285 3.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0005507 copper ion binding Yes
GO:0009308 amine metabolic process Yes
GO:0048038 quinone binding Yes
GO:0008131 primary amine oxidase activity Yes
GO:0008150 biological_process No
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0016641 oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor No
GO:0008152 metabolic process No
GO:0016491 oxidoreductase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7468 0.2604 0.3466 0.223 0.0777 0.0155 0.182 0.2621 0.0936 0.0601

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup60
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6252
Ophiocordyceps australis map64 (Brazil) OphauB2|7551
Ophiocordyceps camponoti-floridani Ophcf2|03843
Ophiocordyceps camponoti-floridani Ophcf2|06915
Ophiocordyceps camponoti-floridani Ophcf2|03099
Ophiocordyceps camponoti-rufipedis Ophun1|1382
Ophiocordyceps camponoti-rufipedis Ophun1|320
Ophiocordyceps camponoti-rufipedis Ophun1|3694
Ophiocordyceps kimflemingae Ophio5|4618
Ophiocordyceps kimflemingae Ophio5|5158
Ophiocordyceps kimflemingae Ophio5|5967
Ophiocordyceps kimflemingae Ophio5|6024
Ophiocordyceps subramaniannii Hirsu2|9792
Ophiocordyceps subramaniannii Hirsu2|1941
Ophiocordyceps subramaniannii Hirsu2|10669 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9801
Ophiocordyceps subramaniannii Hirsu2|10668

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10669
MAAPHPFDPLSAEEIQTAAALVREAHGGGVLFNTVALQEPRKAEAVRWLARREAGTKPARIADVVVIAPGGRVGE
GLVDVGQRKVVEWEWVEGVQPIITMEELQAVEHVVRTDAKVMEQCELSGIGRDEMHKVYCDPWTIGYDERFGSLV
RLQQALMYFRDQVDDCQYQYPLDFCPVYDAGKRQVVHIDVPEVRRPLRRTPPIGYHRAAVEARGGYRQDLKPLEI
TQPEGVSFRLDGRELEWQSWRLHVGFSHREGIVLRDITYNDRGTVRPIFYRLSLAEMVVP*
Coding >Hirsu2|10669
ATGGCTGCTCCTCATCCCTTCGATCCGCTGTCGGCGGAAGAGATCCAGACGGCGGCGGCCCTGGTCAGAGAGGCC
CATGGCGGCGGCGTCCTGTTCAACACGGTCGCACTGCAGGAGCCGCGCAAGGCCGAGGCGGTCCGGTGGCTGGCG
CGGCGCGAGGCCGGGACGAAGCCGGCGCGGATCGCCGATGTGGTCGTCATTGCGCCGGGGGGCCGCGTCGGCGAG
GGCCTTGTTGATGTCGGCCAGCGCAAGGTTGTCGAGTGGGAATGGGTCGAGGGCGTGCAGCCGATTATCACGATG
GAGGAGCTCCAGGCGGTCGAGCACGTCGTGCGCACCGACGCCAAGGTCATGGAGCAGTGCGAGCTGAGCGGCATC
GGCCGCGACGAGATGCACAAGGTCTACTGCGACCCCTGGACGATCGGCTACGACGAGCGGTTCGGAAGCCTCGTG
CGCCTGCAGCAGGCGCTCATGTACTTCCGCGACCAGGTCGACGACTGCCAGTACCAGTACCCGCTCGACTTCTGC
CCGGTCTACGACGCCGGCAAGCGCCAGGTGGTGCACATCGACGTGCCCGAGGTGCGGCGCCCGCTGCGGCGCACG
CCGCCCATCGGCTACCACCGGGCGGCCGTCGAGGCCCGGGGCGGCTACCGCCAGGACCTGAAGCCGCTCGAGATC
ACGCAGCCGGAAGGCGTCTCGTTCCGGCTCGACGGGCGCGAGCTCGAGTGGCAGAGCTGGAGGCTGCACGTCGGC
TTCAGCCACCGCGAGGGCATCGTGCTGCGCGACATCACGTACAACGACCGGGGGACCGTCCGCCCCATCTTCTAC
CGTCTCTCGCTGGCCGAGATGGTGGTGCCCTAG
Transcript >Hirsu2|10669
ATGGCTGCTCCTCATCCCTTCGATCCGCTGTCGGCGGAAGAGATCCAGACGGCGGCGGCCCTGGTCAGAGAGGCC
CATGGCGGCGGCGTCCTGTTCAACACGGTCGCACTGCAGGAGCCGCGCAAGGCCGAGGCGGTCCGGTGGCTGGCG
CGGCGCGAGGCCGGGACGAAGCCGGCGCGGATCGCCGATGTGGTCGTCATTGCGCCGGGGGGCCGCGTCGGCGAG
GGCCTTGTTGATGTCGGCCAGCGCAAGGTTGTCGAGTGGGAATGGGTCGAGGGCGTGCAGCCGATTATCACGATG
GAGGAGCTCCAGGCGGTCGAGCACGTCGTGCGCACCGACGCCAAGGTCATGGAGCAGTGCGAGCTGAGCGGCATC
GGCCGCGACGAGATGCACAAGGTCTACTGCGACCCCTGGACGATCGGCTACGACGAGCGGTTCGGAAGCCTCGTG
CGCCTGCAGCAGGCGCTCATGTACTTCCGCGACCAGGTCGACGACTGCCAGTACCAGTACCCGCTCGACTTCTGC
CCGGTCTACGACGCCGGCAAGCGCCAGGTGGTGCACATCGACGTGCCCGAGGTGCGGCGCCCGCTGCGGCGCACG
CCGCCCATCGGCTACCACCGGGCGGCCGTCGAGGCCCGGGGCGGCTACCGCCAGGACCTGAAGCCGCTCGAGATC
ACGCAGCCGGAAGGCGTCTCGTTCCGGCTCGACGGGCGCGAGCTCGAGTGGCAGAGCTGGAGGCTGCACGTCGGC
TTCAGCCACCGCGAGGGCATCGTGCTGCGCGACATCACGTACAACGACCGGGGGACCGTCCGCCCCATCTTCTAC
CGTCTCTCGCTGGCCGAGATGGTGGTGCCCTAG
Gene >Hirsu2|10669
ATGGCTGCTCCTCATCCCTTCGATCCGCTGTCGGCGGAAGAGATCCAGACGGCGGCGGCCCTGGTCAGAGAGGCC
CATGGCGGCGGCGTCCTGTTCAACACGGTCGCACTGCAGGAGCCGCGCAAGGCCGAGGCGGTCCGGTGGCTGGCG
CGGCGCGAGGCCGGGACGAAGCCGGCGCGGATCGCCGATGTGGTCGTCATTGCGCCGGGGGGCCGCGTCGGCGAG
GGCCTTGTTGATGTCGGCCAGCGCAAGGTTGTCGAGTGGGAATGGGTCGAGGGCGTGCAGCCGATTGTGAGCCCT
CCCGGCCGTCGCCCTCTCGCCTCCCTCTCCCCCATCGCCCGCCGGCCTCTGCCTCGGTGCCTGCCTCTGATGCCG
GCCTAGATCACGATGGAGGAGCTCCAGGCGGTCGAGCACGTCGTGCGCACCGACGCCAAGGTCATGGAGCAGTGC
GAGCTGAGCGGCATCGGCCGCGACGAGATGCACAAGGTCTACTGCGACCCCTGGACGATCGGCTACGACGAGCGG
TTCGGAAGCCTCGTGCGCCTGCAGCAGGCGCTCATGTACTTCCGCGACCAGGTCGACGACTGCCAGTACCAGTAC
CCGCTCGACTTCTGCCCGGTCTACGACGCCGGCAAGCGCCAGGTGGTGCACATCGACGTGCCCGAGGTGCGGCGC
CCGCTGCGGCGCACGCCGCCCATCGGCTACCACCGGGCGGCCGTCGAGGCCCGGGGCGGCTACCGCCAGGACCTG
AAGCCGCTCGAGATCACGCAGCCGGAAGGCGTCTCGTTCCGGCTCGACGGGCGCGAGCTCGAGTGGCAGAGCTGG
AGGCTGCACGTCGGCTTCAGCCACCGCGAGGGCATCGTGCTGCGCGACATCACGTACAACGACCGGGGGACCGTC
CGCCCCATCTTCTACCGTCTCTCGCTGGCCGAGATGGTGGTGCCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail