Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10667
Gene name
LocationContig_887:52..598
Strand+
Gene length (bp)546
Transcript length (bp)546
Coding sequence length (bp)546
Protein length (aa) 182

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 1.3E-16 44 120
PF00043 GST_C Glutathione S-transferase, C-terminal domain 8.4E-05 41 121

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94524|GTO2_SCHPO Glutathione S-transferase omega-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gto2 PE=3 SV=1 3 162 5.0E-72
sp|P36156|GTO2_YEAST Glutathione S-transferase omega-like 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM4 PE=1 SV=1 1 165 1.0E-61
sp|Q04806|GTO3_YEAST Glutathione S-transferase omega-like 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTO3 PE=1 SV=1 1 164 6.0E-52
sp|P42620|YQJG_ECOLI Glutathionyl-hydroquinone reductase YqjG OS=Escherichia coli (strain K12) GN=yqjG PE=1 SV=1 7 158 2.0E-43
sp|P48239|GTO1_YEAST Glutathione S-transferase omega-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTO1 PE=1 SV=1 5 162 1.0E-38

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10667
LLDAEHRAVDLYPPALRARIDEANEWTYDLINNGVYKAGFATTAAAYERHVTALFAALDRAERQLASQKGPYFLG
DALTELDVRLFVTLVRFDPVYVQHFKCNLRDLRSGYPALHRWLRALYWRRPAFRQATRFDHIKWHYTRSHSQINP
LAITPLGPLPHILPLDDEVPAAKAAAAGAVG*
Coding >Hirsu2|10667
CTGCTCGACGCCGAGCACCGCGCCGTGGACCTGTACCCTCCGGCGCTGCGGGCGCGCATCGACGAGGCCAACGAG
TGGACGTACGACCTCATCAACAACGGCGTCTACAAGGCCGGCTTCGCCACCACCGCCGCCGCCTACGAGCGCCAC
GTCACCGCCCTCTTCGCCGCCCTCGACCGGGCCGAGCGCCAGCTCGCGTCCCAGAAGGGGCCCTACTTCTTGGGC
GACGCCCTGACCGAGCTCGACGTCCGCCTCTTCGTCACCCTCGTCCGCTTCGACCCCGTCTACGTCCAGCACTTC
AAGTGCAACCTCCGCGACCTCCGCTCCGGCTACCCGGCCCTGCACCGCTGGCTGCGCGCCCTGTACTGGCGCCGC
CCGGCCTTCCGCCAGGCCACCCGCTTCGACCACATCAAGTGGCACTACACCCGCAGCCACTCCCAGATCAACCCG
CTCGCCATCACCCCGCTCGGGCCCCTGCCGCACATCCTGCCGCTCGACGACGAGGTCCCGGCCGCCAAGGCTGCT
GCCGCGGGGGCTGTGGGCTGA
Transcript >Hirsu2|10667
CTGCTCGACGCCGAGCACCGCGCCGTGGACCTGTACCCTCCGGCGCTGCGGGCGCGCATCGACGAGGCCAACGAG
TGGACGTACGACCTCATCAACAACGGCGTCTACAAGGCCGGCTTCGCCACCACCGCCGCCGCCTACGAGCGCCAC
GTCACCGCCCTCTTCGCCGCCCTCGACCGGGCCGAGCGCCAGCTCGCGTCCCAGAAGGGGCCCTACTTCTTGGGC
GACGCCCTGACCGAGCTCGACGTCCGCCTCTTCGTCACCCTCGTCCGCTTCGACCCCGTCTACGTCCAGCACTTC
AAGTGCAACCTCCGCGACCTCCGCTCCGGCTACCCGGCCCTGCACCGCTGGCTGCGCGCCCTGTACTGGCGCCGC
CCGGCCTTCCGCCAGGCCACCCGCTTCGACCACATCAAGTGGCACTACACCCGCAGCCACTCCCAGATCAACCCG
CTCGCCATCACCCCGCTCGGGCCCCTGCCGCACATCCTGCCGCTCGACGACGAGGTCCCGGCCGCCAAGGCTGCT
GCCGCGGGGGCTGTGGGCTGA
Gene >Hirsu2|10667
CTGCTCGACGCCGAGCACCGCGCCGTGGACCTGTACCCTCCGGCGCTGCGGGCGCGCATCGACGAGGCCAACGAG
TGGACGTACGACCTCATCAACAACGGCGTCTACAAGGCCGGCTTCGCCACCACCGCCGCCGCCTACGAGCGCCAC
GTCACCGCCCTCTTCGCCGCCCTCGACCGGGCCGAGCGCCAGCTCGCGTCCCAGAAGGGGCCCTACTTCTTGGGC
GACGCCCTGACCGAGCTCGACGTCCGCCTCTTCGTCACCCTCGTCCGCTTCGACCCCGTCTACGTCCAGCACTTC
AAGTGCAACCTCCGCGACCTCCGCTCCGGCTACCCGGCCCTGCACCGCTGGCTGCGCGCCCTGTACTGGCGCCGC
CCGGCCTTCCGCCAGGCCACCCGCTTCGACCACATCAAGTGGCACTACACCCGCAGCCACTCCCAGATCAACCCG
CTCGCCATCACCCCGCTCGGGCCCCTGCCGCACATCCTGCCGCTCGACGACGAGGTCCCGGCCGCCAAGGCTGCT
GCCGCGGGGGCTGTGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail