Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10644
Gene name
LocationContig_880:7023..10547
Strand+
Gene length (bp)3524
Transcript length (bp)3273
Coding sequence length (bp)3273
Protein length (aa) 1091

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00916 Sulfate_transp Sulfate permease family 1.4E-54 287 682
PF00027 cNMP_binding Cyclic nucleotide-binding domain 2.9E-15 974 1054
PF01740 STAS STAS domain 1.9E-09 745 839

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09764|YA7B_SCHPO Uncharacterized protein C24H6.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.11c PE=3 SV=1 287 1088 0.0E+00
sp|P53273|YG35_YEAST Uncharacterized vacuolar membrane protein YGR125W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR125W PE=1 SV=1 263 1089 0.0E+00
sp|Q14SY0|BICA_SYNP2 Bicarbonate transporter BicA OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=bicA PE=1 SV=1 372 814 3.0E-06

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0008272 sulfate transport Yes
GO:0015116 sulfate transmembrane transporter activity Yes
GO:0006820 anion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0015698 inorganic anion transport No
GO:0072348 sulfur compound transport No
GO:0006811 ion transport No
GO:1901682 sulfur compound transmembrane transporter activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0015103 inorganic anion transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 287 309 22
2 316 338 22
3 377 399 22
4 411 433 22
5 458 477 19
6 484 506 22
7 538 560 22
8 620 642 22
9 646 668 22
10 681 703 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10644
MSSSALGFSPWARRASSQSLSQARDLAAPDAAGSLSSPDEALVPPPSSRLLSSSAGSSRGMREPIRSYIHASLRH
PSVPVDSAQNALSVRQDTAELASYLLSDDSDQRRPSFLQRSRPSALELFRSEHGGEHVDDDGAIVEESEPTSPES
DFGHAADGADGPSVLSNLLKRSPPDSVVRDAPVSSDARPFEPKWPRRRPSQAEPRLRRPAAQARAAATDETPLLS
EQTSQDPLGDASDVEGQKRSHGKTWFRRLLGRRRAVARAADPRRWDRRAIWQNVFLSPLSCLPAVIVGLLLNILD
ALSYGMILFPLGKPMFAHLGSAGLSIYYVSTIVSQIVFSSGSVFKGAVGSELIEVVPFFHNMASTIMDSVGPEKP
DAVIATTIVAYSASSMMTGLVFYLMGKFRFGSMVGFIPRHILIGCIGGVGWFLIATGFEVSARLDGSLEYNLDTL
VKLTRSDTALLWIFPLVLAIVLFYGQARVRSKYFLPLYILAIPLVFYIFVLSIDVLDVDNLRDHGWIFQGPPPGE
PWWYFYTLYKFELVEWSAVAEVIPAMLALTFFGILHVPINVPALALNCGEDSADLDRELKLHGYSNFLSGCAGSI
QNYLVYANTVFFIRSGGDRRLAGFMLAGLTFGVMTVGPSIIGSIPIMMVATLIFDLGFELLLEAVWLPRKKLKLA
EYLTVVVIVLVMGIYDFVVGIGVGILLAFVSLIIQTSRVSAIRGAYGGDVVTSTVRRNPSQQHYLHRAGQQIYIV
KLTGYLFFGTVVSVEEKIRAMLDDKAFAQKPIKFLILDMWHVSGLDYSAGEAFNTISRLLDGKRVHLVLSGLDAD
SQPGRNLRAVGLGADGIEVLMLPTLNSALESCENELLKTLYARQREFGGGGGGAAAAAAAEEEPATASLDVPGAA
ASPSLASFDPPFNSPRRTHLAEAARSALDSVEVQRPRRWRSFQEPLRLMLQIFQGLSDRNEDFWFQATPYFRRQE
HRAGAVLFRRGEPAAGFYLVESGIVRAEYDLPQGWLYESIVAGTTCGELPFFSETARTATAQVDRDCVVWVMDRD
RWRAAQTERPDVARELLRVSLKLTSERMSAITSHILAMAG*
Coding >Hirsu2|10644
ATGTCCAGCTCCGCCTTGGGCTTCTCCCCCTGGGCCAGGAGGGCGTCCAGCCAGTCCCTGTCCCAGGCGCGGGAC
CTGGCCGCCCCCGACGCCGCCGGCAGTCTGAGCTCGCCCGACGAAGCCCTGGTGCCCCCGCCGTCGTCCCGGCTG
CTGTCCTCCTCGGCCGGCTCCTCCCGGGGGATGCGAGAGCCGATCCGGTCCTACATCCATGCCTCGTTGCGCCAC
CCGTCCGTGCCCGTGGACAGCGCCCAGAACGCCCTGTCCGTCCGTCAAGACACGGCCGAGCTGGCGAGTTACCTC
TTGTCCGATGACTCGGATCAGCGCCGCCCCTCTTTCCTCCAACGCTCGAGGCCGTCCGCCCTCGAGCTCTTCCGG
TCCGAGCACGGCGGCGAGCATGTCGACGACGACGGCGCCATCGTCGAGGAGTCGGAGCCGACGTCGCCCGAAAGC
GACTTTGGCCATGCGGCCGACGGCGCTGACGGGCCGTCCGTGCTGTCCAACCTCCTCAAGAGATCCCCCCCGGAC
TCGGTCGTTCGCGACGCGCCCGTCTCGTCCGACGCTCGCCCCTTCGAACCCAAGTGGCCGCGACGCCGGCCGAGC
CAAGCAGAACCGCGACTTCGCCGCCCCGCCGCCCAAGCTCGAGCCGCCGCCACCGACGAGACGCCTCTGCTGAGC
GAGCAAACCTCTCAGGACCCGCTCGGCGACGCGTCCGACGTCGAGGGGCAGAAGCGGTCCCACGGCAAGACGTGG
TTTCGCCGACTGCTGGGGCGCCGTCGCGCCGTCGCCCGGGCGGCCGACCCGCGCCGATGGGATCGGAGAGCAATC
TGGCAAAACGTCTTTCTGAGCCCGCTGTCTTGTCTGCCCGCCGTCATTGTCGGCCTTCTCCTCAACATCCTAGAC
GCCCTTTCCTACGGCATGATCTTATTCCCGCTGGGAAAGCCAATGTTTGCTCATCTGGGGTCTGCCGGCCTCTCC
ATATACTACGTCAGCACGATCGTCTCCCAAATCGTTTTTTCCTCCGGAAGCGTCTTCAAGGGAGCCGTTGGATCT
GAACTGATCGAAGTCGTCCCCTTTTTCCACAACATGGCCTCGACCATCATGGACAGTGTCGGGCCCGAGAAGCCG
GATGCGGTCATCGCAACGACCATCGTGGCTTACTCGGCGAGCTCCATGATGACCGGCCTCGTCTTTTATCTCATG
GGCAAATTCAGGTTCGGATCCATGGTCGGCTTCATCCCCAGACACATACTCATCGGCTGCATCGGCGGCGTCGGC
TGGTTCCTCATCGCGACCGGCTTCGAGGTCTCGGCCCGTCTCGACGGCAGCCTCGAGTACAACCTCGACACGCTC
GTCAAGCTCACGAGGTCCGACACCGCCCTGCTGTGGATCTTTCCTTTGGTCCTCGCCATCGTCCTCTTCTACGGC
CAAGCAAGAGTACGGTCCAAGTATTTCCTGCCGCTCTATATTCTCGCCATACCACTGGTTTTCTACATCTTTGTT
CTGTCCATCGACGTTTTGGATGTCGACAATTTGCGTGACCACGGTTGGATATTTCAAGGGCCGCCTCCGGGAGAG
CCCTGGTGGTATTTTTACACCCTATACAAATTCGAACTGGTCGAATGGAGCGCCGTGGCCGAGGTGATCCCCGCG
ATGCTCGCCCTGACCTTCTTCGGCATCCTCCACGTCCCGATCAACGTGCCGGCCCTGGCGCTCAACTGCGGCGAG
GACAGCGCGGACCTGGACCGGGAGCTGAAGCTGCACGGCTACTCCAACTTCCTGTCGGGCTGTGCCGGCAGCATC
CAGAACTACCTGGTCTACGCCAACACCGTCTTCTTCATCCGCTCCGGCGGCGACAGGCGGCTGGCCGGCTTCATG
CTGGCCGGCCTCACGTTCGGCGTCATGACGGTCGGCCCGTCCATCATCGGCTCCATCCCGATCATGATGGTGGCC
ACGCTCATCTTCGACCTCGGCTTCGAGCTCCTCCTCGAGGCCGTCTGGCTCCCGCGGAAGAAGCTGAAGCTGGCC
GAGTACCTGACCGTCGTCGTCATCGTGCTCGTCATGGGCATCTACGACTTCGTCGTCGGCATCGGCGTCGGCATC
CTGCTGGCCTTCGTCTCCCTCATCATCCAGACGTCGAGGGTGTCGGCCATCCGGGGCGCGTACGGCGGCGACGTC
GTCACCTCGACCGTCCGCCGCAACCCGTCGCAGCAGCACTACCTGCACCGGGCCGGGCAGCAGATCTACATCGTC
AAGCTGACCGGCTACCTCTTCTTCGGCACGGTCGTCAGCGTCGAGGAGAAGATCCGGGCGATGCTGGACGACAAG
GCGTTCGCGCAGAAGCCCATCAAGTTCCTCATCCTCGACATGTGGCACGTCAGCGGCCTCGACTACTCGGCCGGC
GAGGCCTTCAACACCATCAGCCGCCTCCTCGACGGCAAGCGCGTCCACCTGGTCCTCAGCGGCCTGGACGCCGAC
AGCCAGCCGGGGCGCAACCTGCGGGCGGTGGGGCTGGGCGCCGACGGGATCGAGGTGCTCATGCTGCCGACGCTC
AACTCGGCGCTGGAGAGCTGCGAGAACGAGCTGCTCAAGACGCTCTACGCCCGGCAGCGGGAGTTTGGCGGCGGC
GGCGGCGGGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGCCGGCGACGGCGAGCCTGGACGTGCCGGGCGCGGCG
GCGTCCCCGTCGCTCGCCTCCTTCGACCCGCCCTTCAACTCGCCGCGGCGGACGCACCTGGCGGAGGCGGCGCGG
TCGGCGCTCGACAGCGTCGAGGTGCAGCGGCCGCGGCGGTGGCGCAGCTTCCAGGAGCCGCTGCGGCTGATGCTG
CAGATCTTCCAGGGGCTCAGCGACCGCAACGAGGACTTTTGGTTCCAGGCGACGCCCTACTTCCGGCGGCAGGAG
CACCGGGCCGGGGCGGTGCTCTTCCGGCGCGGCGAGCCGGCCGCCGGCTTCTACCTGGTCGAGAGCGGCATCGTG
CGGGCCGAGTACGACCTGCCGCAGGGCTGGCTGTACGAGAGCATCGTGGCCGGCACCACCTGCGGCGAGCTGCCC
TTCTTCTCCGAGACGGCGCGCACGGCCACGGCCCAGGTCGACCGCGACTGCGTCGTCTGGGTCATGGACCGCGAC
CGCTGGCGCGCCGCCCAGACGGAGCGGCCCGACGTCGCGCGCGAGCTGCTCCGCGTCTCGCTCAAGCTGACGAGC
GAGCGCATGAGCGCCATCACCTCGCACATACTGGCCATGGCGGGATGA
Transcript >Hirsu2|10644
ATGTCCAGCTCCGCCTTGGGCTTCTCCCCCTGGGCCAGGAGGGCGTCCAGCCAGTCCCTGTCCCAGGCGCGGGAC
CTGGCCGCCCCCGACGCCGCCGGCAGTCTGAGCTCGCCCGACGAAGCCCTGGTGCCCCCGCCGTCGTCCCGGCTG
CTGTCCTCCTCGGCCGGCTCCTCCCGGGGGATGCGAGAGCCGATCCGGTCCTACATCCATGCCTCGTTGCGCCAC
CCGTCCGTGCCCGTGGACAGCGCCCAGAACGCCCTGTCCGTCCGTCAAGACACGGCCGAGCTGGCGAGTTACCTC
TTGTCCGATGACTCGGATCAGCGCCGCCCCTCTTTCCTCCAACGCTCGAGGCCGTCCGCCCTCGAGCTCTTCCGG
TCCGAGCACGGCGGCGAGCATGTCGACGACGACGGCGCCATCGTCGAGGAGTCGGAGCCGACGTCGCCCGAAAGC
GACTTTGGCCATGCGGCCGACGGCGCTGACGGGCCGTCCGTGCTGTCCAACCTCCTCAAGAGATCCCCCCCGGAC
TCGGTCGTTCGCGACGCGCCCGTCTCGTCCGACGCTCGCCCCTTCGAACCCAAGTGGCCGCGACGCCGGCCGAGC
CAAGCAGAACCGCGACTTCGCCGCCCCGCCGCCCAAGCTCGAGCCGCCGCCACCGACGAGACGCCTCTGCTGAGC
GAGCAAACCTCTCAGGACCCGCTCGGCGACGCGTCCGACGTCGAGGGGCAGAAGCGGTCCCACGGCAAGACGTGG
TTTCGCCGACTGCTGGGGCGCCGTCGCGCCGTCGCCCGGGCGGCCGACCCGCGCCGATGGGATCGGAGAGCAATC
TGGCAAAACGTCTTTCTGAGCCCGCTGTCTTGTCTGCCCGCCGTCATTGTCGGCCTTCTCCTCAACATCCTAGAC
GCCCTTTCCTACGGCATGATCTTATTCCCGCTGGGAAAGCCAATGTTTGCTCATCTGGGGTCTGCCGGCCTCTCC
ATATACTACGTCAGCACGATCGTCTCCCAAATCGTTTTTTCCTCCGGAAGCGTCTTCAAGGGAGCCGTTGGATCT
GAACTGATCGAAGTCGTCCCCTTTTTCCACAACATGGCCTCGACCATCATGGACAGTGTCGGGCCCGAGAAGCCG
GATGCGGTCATCGCAACGACCATCGTGGCTTACTCGGCGAGCTCCATGATGACCGGCCTCGTCTTTTATCTCATG
GGCAAATTCAGGTTCGGATCCATGGTCGGCTTCATCCCCAGACACATACTCATCGGCTGCATCGGCGGCGTCGGC
TGGTTCCTCATCGCGACCGGCTTCGAGGTCTCGGCCCGTCTCGACGGCAGCCTCGAGTACAACCTCGACACGCTC
GTCAAGCTCACGAGGTCCGACACCGCCCTGCTGTGGATCTTTCCTTTGGTCCTCGCCATCGTCCTCTTCTACGGC
CAAGCAAGAGTACGGTCCAAGTATTTCCTGCCGCTCTATATTCTCGCCATACCACTGGTTTTCTACATCTTTGTT
CTGTCCATCGACGTTTTGGATGTCGACAATTTGCGTGACCACGGTTGGATATTTCAAGGGCCGCCTCCGGGAGAG
CCCTGGTGGTATTTTTACACCCTATACAAATTCGAACTGGTCGAATGGAGCGCCGTGGCCGAGGTGATCCCCGCG
ATGCTCGCCCTGACCTTCTTCGGCATCCTCCACGTCCCGATCAACGTGCCGGCCCTGGCGCTCAACTGCGGCGAG
GACAGCGCGGACCTGGACCGGGAGCTGAAGCTGCACGGCTACTCCAACTTCCTGTCGGGCTGTGCCGGCAGCATC
CAGAACTACCTGGTCTACGCCAACACCGTCTTCTTCATCCGCTCCGGCGGCGACAGGCGGCTGGCCGGCTTCATG
CTGGCCGGCCTCACGTTCGGCGTCATGACGGTCGGCCCGTCCATCATCGGCTCCATCCCGATCATGATGGTGGCC
ACGCTCATCTTCGACCTCGGCTTCGAGCTCCTCCTCGAGGCCGTCTGGCTCCCGCGGAAGAAGCTGAAGCTGGCC
GAGTACCTGACCGTCGTCGTCATCGTGCTCGTCATGGGCATCTACGACTTCGTCGTCGGCATCGGCGTCGGCATC
CTGCTGGCCTTCGTCTCCCTCATCATCCAGACGTCGAGGGTGTCGGCCATCCGGGGCGCGTACGGCGGCGACGTC
GTCACCTCGACCGTCCGCCGCAACCCGTCGCAGCAGCACTACCTGCACCGGGCCGGGCAGCAGATCTACATCGTC
AAGCTGACCGGCTACCTCTTCTTCGGCACGGTCGTCAGCGTCGAGGAGAAGATCCGGGCGATGCTGGACGACAAG
GCGTTCGCGCAGAAGCCCATCAAGTTCCTCATCCTCGACATGTGGCACGTCAGCGGCCTCGACTACTCGGCCGGC
GAGGCCTTCAACACCATCAGCCGCCTCCTCGACGGCAAGCGCGTCCACCTGGTCCTCAGCGGCCTGGACGCCGAC
AGCCAGCCGGGGCGCAACCTGCGGGCGGTGGGGCTGGGCGCCGACGGGATCGAGGTGCTCATGCTGCCGACGCTC
AACTCGGCGCTGGAGAGCTGCGAGAACGAGCTGCTCAAGACGCTCTACGCCCGGCAGCGGGAGTTTGGCGGCGGC
GGCGGCGGGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGCCGGCGACGGCGAGCCTGGACGTGCCGGGCGCGGCG
GCGTCCCCGTCGCTCGCCTCCTTCGACCCGCCCTTCAACTCGCCGCGGCGGACGCACCTGGCGGAGGCGGCGCGG
TCGGCGCTCGACAGCGTCGAGGTGCAGCGGCCGCGGCGGTGGCGCAGCTTCCAGGAGCCGCTGCGGCTGATGCTG
CAGATCTTCCAGGGGCTCAGCGACCGCAACGAGGACTTTTGGTTCCAGGCGACGCCCTACTTCCGGCGGCAGGAG
CACCGGGCCGGGGCGGTGCTCTTCCGGCGCGGCGAGCCGGCCGCCGGCTTCTACCTGGTCGAGAGCGGCATCGTG
CGGGCCGAGTACGACCTGCCGCAGGGCTGGCTGTACGAGAGCATCGTGGCCGGCACCACCTGCGGCGAGCTGCCC
TTCTTCTCCGAGACGGCGCGCACGGCCACGGCCCAGGTCGACCGCGACTGCGTCGTCTGGGTCATGGACCGCGAC
CGCTGGCGCGCCGCCCAGACGGAGCGGCCCGACGTCGCGCGCGAGCTGCTCCGCGTCTCGCTCAAGCTGACGAGC
GAGCGCATGAGCGCCATCACCTCGCACATACTGGCCATGGCGGGATGA
Gene >Hirsu2|10644
ATGTCCAGCTCCGCCTTGGGCTTCTCCCCCTGGGCCAGGAGGGCGTCCAGCCAGTCCCTGTCCCAGGCGCGGGAC
CTGGCCGCCCCCGACGCCGCCGGCAGTCTGAGCTCGCCCGACGAAGCCCTGGTGCCCCCGCCGTCGTCCCGGCTG
CTGTCCTCCTCGGCCGGCTCCTCCCGGGGGATGCGAGAGCCGATCCGGTCCTACATCCATGCCTCGTTGCGCCAC
CCGTCCGGTGAGCTCGCCCGCGCCCTGGCCCTGGAGTCCGCTGACTTTGGACAGTGCCCGTGGACAGCGCCCAGA
ACGCCCTGTCCGTCCGTCAAGACACGGCCGAGCTGGCGAGTTACCTCTTGTCCGATGACTCGGATCAGCGCCGCC
CCTCTTTCCTCCAACGCTCGAGGCCGTCCGCCCTCGAGCTCTTCCGGTCCGAGCACGGCGGCGAGCATGTCGACG
ACGACGGCGCCATCGTCGAGGAGTCGGAGCCGACGTCGCCCGAAAGCGACTTTGGCCATGCGGCCGACGGCGCTG
ACGGGCCGTCCGTGCTGTCCAACCTCCTCAAGAGATCCCCCCCGGACTCGGTCGTTCGCGACGCGCCCGTCTCGT
CCGACGCTCGCCCCTTCGAACCCAAGTGGCCGCGACGCCGGCCGAGCCAAGCAGAACCGCGACTTCGCCGCCCCG
CCGCCCAAGCTCGAGCCGCCGCCACCGACGAGACGCCTCTGCTGAGCGAGCAAACCTCTCAGGACCCGCTCGGCG
ACGCGTCCGACGTCGAGGGGCAGAAGCGGTCCCACGGCAAGACGTGGTTTCGCCGACTGCTGGGGCGCCGTCGCG
CCGTCGCCCGGGCGGCCGACCCGCGCCGATGGGATCGGAGAGCAATCTGGCAAAACGTCTTTCTGAGCCCGCTGT
CTTGTCTGCCCGCCGTCATTGTCGGCCTTCTCCTCAACATCCTAGACGCCCTTTCCTACGGTGAGTTCTTTCTTT
GCCGATCTGCACCGTTGGGTCTACTGACCGAGCCGCATAGGCATGATCTTATTCCCGCTGGGAAAGCCAATGTTT
GCTCATCTGGGGTCTGCCGGCCTCTCCATATACTACGTCAGCACGATCGTCTCCCAAATCGTTTTTTCCTCCGGA
AGCGTCTTCAAGGGAGCCGTTGGATCTGAACTGGTACGAGCTGATGCGATACAACTCGGCTCACCCCGCATCGCA
GCGCTGACCTCGAGACCGCAGATCGAAGTCGTCCCCTTTTTCCACAACATGGCCTCGACCATCATGGACAGTGTC
GGGCCCGAGAAGCCGGATGCGGTCATCGCAACGACCATCGTGGCTTACTCGGCGAGCTCCATGATGACCGGCCTC
GTCTTTTATCTCATGGGCAAATTCAGGTTCGGATCCATGGTCGGCTTCATCCCCAGACACATACTCATCGGCTGC
ATCGGCGGCGTCGGCTGGTTCCTCATCGCGACCGGCTTCGAGGTCTCGGCCCGTCTCGACGGCAGCCTCGAGTAC
AACCTCGACACGCTCGTCAAGCTCACGAGGTCCGACACCGCCCTGCTGTGGATCTTTCCTTTGGTCCTCGCCATC
GTCCTCTTCTACGGCCAAGCAAGAGTACGGTCCAAGTATTTCCTGCCGCTCTATATTCTCGCCATACCACTGGTT
TTCTACATCTTTGTTCTGTCCATCGACGTTTTGGATGTCGACAATTTGCGTGACCACGGTTGGATATTTCAAGGG
CCGCCTCCGGGAGAGCCCTGGTGGTATTTTTACACCCTATACAGTGAGTTTTTTTTTTTTTTTTTGGCGCGGCGG
CGCGGCGGCGCGGCCGACGAGGGTTATCGGGAGCGTGGGCTGACGGGGCGTCAGAATTCGAACTGGTCGAATGGA
GCGCCGTGGCCGAGGTGATCCCCGCGATGCTCGCCCTGACCTTCTTCGGCATCCTCCACGTCCCGATCAACGTGC
CGGCCCTGGCGCTCAACTGCGGCGAGGACAGCGCGGACCTGGACCGGGAGCTGAAGCTGCACGGCTACTCCAACT
TCCTGTCGGGCTGTGCCGGCAGCATCCAGAACTACCTGGTCTACGCCAACACCGTCTTCTTCATCCGCTCCGGCG
GCGACAGGCGGCTGGCCGGCTTCATGCTGGCCGGCCTCACGTTCGGCGTCATGACGGTCGGCCCGTCCATCATCG
GCTCCATCCCGATCATGATGGTGGCCACGCTCATCTTCGACCTCGGCTTCGAGCTCCTCCTCGAGGCCGTCTGGC
TCCCGCGGAAGAAGCTGAAGCTGGCCGAGTACCTGACCGTCGTCGTCATCGTGCTCGTCATGGGCATCTACGACT
TCGTCGTCGGCATCGGCGTCGGCATCCTGCTGGCCTTCGTCTCCCTCATCATCCAGACGTCGAGGGTGTCGGCCA
TCCGGGGCGCGTACGGCGGCGACGTCGTCACCTCGACCGTCCGCCGCAACCCGTCGCAGCAGCACTACCTGCACC
GGGCCGGGCAGCAGATCTACATCGTCAAGCTGACCGGCTACCTCTTCTTCGGCACGGTCGTCAGCGTCGAGGAGA
AGATCCGGGCGATGCTGGACGACAAGGCGTTCGCGCAGAAGCCCATCAAGTTCCTCATCCTCGACATGTGGCACG
TCAGCGGCCTCGACTACTCGGCCGGCGAGGCCTTCAACACCATCAGCCGCCTCCTCGACGGCAAGCGCGTCCACC
TGGTCCTCAGCGGCCTGGACGCCGACAGCCAGCCGGGGCGCAACCTGCGGGCGGTGGGGCTGGGCGCCGACGGGA
TCGAGGTGCTCATGCTGCCGACGCTCAACTCGGCGCTGGAGAGCTGCGAGAACGAGCTGCTCAAGACGCTCTACG
CCCGGCAGCGGGAGTTTGGCGGCGGCGGCGGCGGGGCGGCGGCGGCGGCGGCGGCGGAGGAGGAGCCGGCGACGG
CGAGCCTGGACGTGCCGGGCGCGGCGGCGTCCCCGTCGCTCGCCTCCTTCGACCCGCCCTTCAACTCGCCGCGGC
GGACGCACCTGGCGGAGGCGGCGCGGTCGGCGCTCGACAGCGTCGAGGTGCAGCGGCCGCGGCGGTGGCGCAGCT
TCCAGGAGCCGCTGCGGCTGATGCTGCAGATCTTCCAGGGGCTCAGCGACCGCAACGAGGACTTTTGGTTCCAGG
CGACGCCCTACTTCCGGCGGCAGGAGCACCGGGCCGGGGCGGTGCTCTTCCGGCGCGGCGAGCCGGCCGCCGGCT
TCTACCTGGTCGAGAGCGGCATCGTGCGGGCCGAGTACGACCTGCCGCAGGGCTGGCTGTACGAGAGCATCGTGG
CCGGCACCACCTGCGGCGAGCTGCCCTTCTTCTCCGAGACGGCGCGCACGGCCACGGCCCAGGTCGACCGCGACT
GCGTCGTCTGGGTCATGGACCGCGACCGCTGGCGCGCCGCCCAGACGGAGCGGCCCGACGTCGCGCGCGAGCTGC
TCCGCGTCTCGCTCAAGCTGACGAGCGAGCGCATGAGCGCCATCACCTCGCACATACTGGCCATGGCGGGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail