Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10642
Gene name
LocationContig_880:1750..3250
Strand-
Gene length (bp)1500
Transcript length (bp)1176
Coding sequence length (bp)1176
Protein length (aa) 392

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04683 Proteasom_Rpn13 Proteasome complex subunit Rpn13 ubiquitin receptor 9.5E-28 12 107
PF16550 RPN13_C UCH-binding domain 3.5E-09 245 357

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7K2G1|ADRM1_DROME Proteasomal ubiquitin receptor ADRM1 homolog OS=Drosophila melanogaster GN=Rpn13 PE=1 SV=1 7 131 4.0E-12
sp|Q9Y7Y6|YOY4_SCHPO Uncharacterized protein C342.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC342.04 PE=3 SV=1 6 385 7.0E-12
sp|Q7ZXD6|ADM1B_XENLA Proteasomal ubiquitin receptor ADRM1-B OS=Xenopus laevis GN=adrm1-b PE=2 SV=1 6 106 9.0E-12
sp|Q98SH3|ADRM1_CHICK Proteasomal ubiquitin receptor ADRM1 OS=Gallus gallus GN=ADRM1 PE=2 SV=1 6 106 2.0E-11
sp|Q6GN67|ADM1A_XENLA Proteasomal ubiquitin receptor ADRM1-A OS=Xenopus laevis GN=adrm1-a PE=2 SV=2 6 106 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7K2G1|ADRM1_DROME Proteasomal ubiquitin receptor ADRM1 homolog OS=Drosophila melanogaster GN=Rpn13 PE=1 SV=1 7 131 4.0E-12
sp|Q9Y7Y6|YOY4_SCHPO Uncharacterized protein C342.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC342.04 PE=3 SV=1 6 385 7.0E-12
sp|Q7ZXD6|ADM1B_XENLA Proteasomal ubiquitin receptor ADRM1-B OS=Xenopus laevis GN=adrm1-b PE=2 SV=1 6 106 9.0E-12
sp|Q98SH3|ADRM1_CHICK Proteasomal ubiquitin receptor ADRM1 OS=Gallus gallus GN=ADRM1 PE=2 SV=1 6 106 2.0E-11
sp|Q6GN67|ADM1A_XENLA Proteasomal ubiquitin receptor ADRM1-A OS=Xenopus laevis GN=adrm1-a PE=2 SV=2 6 106 2.0E-11
sp|Q6P877|ADRM1_XENTR Proteasomal ubiquitin receptor ADRM1 OS=Xenopus tropicalis GN=adrm1 PE=2 SV=1 6 106 2.0E-11
sp|Q16186|ADRM1_HUMAN Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens GN=ADRM1 PE=1 SV=2 6 106 2.0E-11
sp|A1L5A6|ADRM1_BOVIN Proteasomal ubiquitin receptor ADRM1 OS=Bos taurus GN=ADRM1 PE=2 SV=1 6 106 3.0E-11
sp|Q6NZ09|ADRM1_DANRE Proteasomal ubiquitin receptor ADRM1 OS=Danio rerio GN=adrm1b PE=1 SV=1 6 106 6.0E-11
sp|Q9JMB5|ADRM1_RAT Proteasomal ubiquitin receptor ADRM1 OS=Rattus norvegicus GN=Adrm1 PE=1 SV=2 6 106 6.0E-11
sp|Q9JKV1|ADRM1_MOUSE Proteasomal ubiquitin receptor ADRM1 OS=Mus musculus GN=Adrm1 PE=1 SV=2 6 106 9.0E-11
sp|Q9USM1|ADRM1_SCHPO Probable proteasomal ubiquitin receptor ADRM1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC16A11.16c PE=3 SV=1 32 158 1.0E-08
sp|Q09289|ADRM1_CAEEL Proteasomal ubiquitin receptor ADRM1 homolog OS=Caenorhabditis elegans GN=C56G2.7 PE=3 SV=2 6 106 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0005634 nucleus Yes
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0044464 cell part No
GO:0043226 organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0044424 intracellular part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10642
MPVAPIITFKAGQCDVDTSSTPAKVKPQPEPGYIYLYSEDDLVHFCWRKRSSPLDDPELDLVMVPTDGSFVPYEY
GPTSQPTAKTNGRIFVLKFDSSSQRHLFWMQSKPQSRTGDASWFSPRDRKIGDIVHRLLQGEEVSVTGELAAVRN
VDDRRDEDDDEPMEDVEGRRGSHSHRRGGGSGGAGPDATGGDIREEGEGSREGGADGARAASSSASDAAAAVRNF
LQSLSGQPGLSGAPRQQNADLPFPHLTHLLPTSITVSMVDAAPAEFADTLLSFLPPAVVVLGSGSARLEGRREPT
AEAAEAAKASMSLGDKRALLKKVMRSPQFHQALATLTAALRDGGLPGVAEALGIRVENGGYVRDGGMPMGGGQAV
KAFVDGVKRKVQERDP*
Coding >Hirsu2|10642
ATGCCCGTCGCTCCCATCATCACCTTCAAGGCTGGCCAGTGTGACGTCGACACGTCCTCGACGCCAGCCAAGGTC
AAGCCGCAGCCAGAGCCCGGCTACATCTACCTATATTCCGAAGATGACTTGGTGCACTTTTGCTGGCGGAAGCGG
AGCAGCCCGCTAGATGACCCCGAACTGGACCTCGTCATGGTGCCGACCGACGGCAGCTTTGTGCCCTACGAGTAC
GGCCCGACGTCGCAGCCGACGGCCAAGACGAACGGTCGCATATTCGTCCTCAAGTTCGACTCGTCGTCGCAGCGG
CACCTTTTCTGGATGCAGTCCAAGCCCCAAAGTCGGACCGGGGATGCGAGCTGGTTCAGCCCCAGAGACCGCAAG
ATCGGCGACATTGTCCACCGCCTCCTGCAAGGAGAGGAAGTCAGCGTGACGGGCGAGCTGGCGGCGGTCCGCAAT
GTGGACGACCGGCGAGACGAGGACGACGACGAGCCGATGGAAGATGTCGAGGGCCGCCGCGGTTCACACAGCCAC
CGCCGCGGCGGCGGCAGCGGCGGCGCAGGGCCTGACGCCACCGGGGGAGACATCAGGGAAGAGGGCGAGGGCTCG
AGAGAGGGCGGAGCTGACGGCGCGAGAGCAGCCTCCTCGTCTGCGTCGGATGCGGCGGCCGCCGTGAGAAACTTC
CTGCAGTCCCTGAGCGGCCAACCAGGGCTGTCCGGGGCTCCGCGACAGCAGAACGCGGACCTGCCATTCCCCCAC
CTCACCCATCTTCTCCCCACCTCGATAACCGTGTCCATGGTGGACGCCGCGCCGGCCGAATTCGCCGACACGCTT
CTCAGCTTCCTGCCGCCCGCGGTGGTGGTGCTCGGCAGCGGCTCGGCCAGGCTCGAGGGCAGGCGGGAGCCGACG
GCCGAGGCGGCCGAGGCGGCCAAGGCCTCCATGTCGCTCGGGGACAAGCGGGCCCTTCTCAAGAAGGTGATGCGC
AGCCCGCAATTCCACCAGGCCCTGGCGACCCTGACGGCGGCCCTGCGCGACGGCGGCCTTCCCGGCGTGGCCGAG
GCGCTCGGGATCCGGGTAGAGAACGGCGGATACGTCAGGGACGGCGGGATGCCCATGGGCGGTGGCCAGGCGGTC
AAGGCTTTCGTGGACGGGGTCAAGAGGAAGGTCCAGGAGCGGGATCCGTGA
Transcript >Hirsu2|10642
ATGCCCGTCGCTCCCATCATCACCTTCAAGGCTGGCCAGTGTGACGTCGACACGTCCTCGACGCCAGCCAAGGTC
AAGCCGCAGCCAGAGCCCGGCTACATCTACCTATATTCCGAAGATGACTTGGTGCACTTTTGCTGGCGGAAGCGG
AGCAGCCCGCTAGATGACCCCGAACTGGACCTCGTCATGGTGCCGACCGACGGCAGCTTTGTGCCCTACGAGTAC
GGCCCGACGTCGCAGCCGACGGCCAAGACGAACGGTCGCATATTCGTCCTCAAGTTCGACTCGTCGTCGCAGCGG
CACCTTTTCTGGATGCAGTCCAAGCCCCAAAGTCGGACCGGGGATGCGAGCTGGTTCAGCCCCAGAGACCGCAAG
ATCGGCGACATTGTCCACCGCCTCCTGCAAGGAGAGGAAGTCAGCGTGACGGGCGAGCTGGCGGCGGTCCGCAAT
GTGGACGACCGGCGAGACGAGGACGACGACGAGCCGATGGAAGATGTCGAGGGCCGCCGCGGTTCACACAGCCAC
CGCCGCGGCGGCGGCAGCGGCGGCGCAGGGCCTGACGCCACCGGGGGAGACATCAGGGAAGAGGGCGAGGGCTCG
AGAGAGGGCGGAGCTGACGGCGCGAGAGCAGCCTCCTCGTCTGCGTCGGATGCGGCGGCCGCCGTGAGAAACTTC
CTGCAGTCCCTGAGCGGCCAACCAGGGCTGTCCGGGGCTCCGCGACAGCAGAACGCGGACCTGCCATTCCCCCAC
CTCACCCATCTTCTCCCCACCTCGATAACCGTGTCCATGGTGGACGCCGCGCCGGCCGAATTCGCCGACACGCTT
CTCAGCTTCCTGCCGCCCGCGGTGGTGGTGCTCGGCAGCGGCTCGGCCAGGCTCGAGGGCAGGCGGGAGCCGACG
GCCGAGGCGGCCGAGGCGGCCAAGGCCTCCATGTCGCTCGGGGACAAGCGGGCCCTTCTCAAGAAGGTGATGCGC
AGCCCGCAATTCCACCAGGCCCTGGCGACCCTGACGGCGGCCCTGCGCGACGGCGGCCTTCCCGGCGTGGCCGAG
GCGCTCGGGATCCGGGTAGAGAACGGCGGATACGTCAGGGACGGCGGGATGCCCATGGGCGGTGGCCAGGCGGTC
AAGGCTTTCGTGGACGGGGTCAAGAGGAAGGTCCAGGAGCGGGATCCGTGA
Gene >Hirsu2|10642
ATGCCCGTCGCTCCCATCATCACCTTCAAGGCTGGCCAGTGTGACGTCGACGTGAGTTTCGGGACCGTCGCCATT
ACACCTCGTGATGGGTTACTGATGGCGGCCGCGGTAGACGTCCTCGACGCCAGCCAAGGTCAAGCCGCAGCCAGA
GCCCGGCTACATCTACCTATATTCCGAAGATGGTTCGTTCCTGGGCGTGCCGCGGGCCCGCACGCAAATGGCATG
CTGACGGATGGTAGACTTGGTGCACTTTTGCTGGCGGAAGCGGAGCAGCCCGCTAGATGACCCCGAACTGGACCT
CGTCATGGTGCCGACCGACGGCAGCTTTGTGCCCTACGAGTACGGCCCGACGTCGCAGCCGACGGCCAAGACGAA
CGGTCGCATATTCGTCCTCAAGTTCGACTCGTCGTCGCAGCGGCACCTTTTCTGGATGCAGTCCAAGCCCCAAAG
TCGGACCGGGGATGCGAGCTGGTTCAGCCCCAGAGACCGCAAGATCGGCGACATTGTCCACCGCCTCCTGCAAGG
AGAGGAAGTCAGCGTGACGGGCGAGCTGGCGGCGGTCCGCAATGTGGACGACCGGCGAGACGAGGACGACGACGA
GCCGATGGAAGATGTCGAGGGCCGCCGCGGTTCACACAGCCACCGCCGCGGCGGCGGCAGCGGCGGCGCAGGGCC
TGACGCCACCGGGGGAGACATCAGGGAAGAGGGCGAGGGCTCGAGAGAGGGCGGAGCTGACGGCGCGAGAGCGTA
GGTGATTCCCATCTCATGGTTGACTGTCGGAGGCGCATGTTTGGGCACTTGAGGTCGGCGATTGGCAAGAGGAAG
GGTCAAGCCATTCAGACTCGGCACTGCACCTTGGTGCGCGTCTAAATTGAAATCAAATGCCACCATCGGCAAGGC
TCGACGTGAATCTGCACGGCTCGGGGGCGGTAGGCTGACCACGCTACTCATAGAGCCTCCTCGTCTGCGTCGGAT
GCGGCGGCCGCCGTGAGAAACTTCCTGCAGTCCCTGAGCGGCCAACCAGGGCTGTCCGGGGCTCCGCGACAGCAG
AACGCGGACCTGCCATTCCCCCACCTCACCCATCTTCTCCCCACCTCGATAACCGTGTCCATGGTGGACGCCGCG
CCGGCCGAATTCGCCGACACGCTTCTCAGCTTCCTGCCGCCCGCGGTGGTGGTGCTCGGCAGCGGCTCGGCCAGG
CTCGAGGGCAGGCGGGAGCCGACGGCCGAGGCGGCCGAGGCGGCCAAGGCCTCCATGTCGCTCGGGGACAAGCGG
GCCCTTCTCAAGAAGGTGATGCGCAGCCCGCAATTCCACCAGGCCCTGGCGACCCTGACGGCGGCCCTGCGCGAC
GGCGGCCTTCCCGGCGTGGCCGAGGCGCTCGGGATCCGGGTAGAGAACGGCGGATACGTCAGGGACGGCGGGATG
CCCATGGGCGGTGGCCAGGCGGTCAAGGCTTTCGTGGACGGGGTCAAGAGGAAGGTCCAGGAGCGGGATCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail