Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10639
Gene name
LocationContig_88:37792..39567
Strand-
Gene length (bp)1775
Transcript length (bp)1539
Coding sequence length (bp)1539
Protein length (aa) 513

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 4.5E-21 64 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 48 500 2.0E-47
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 1 500 1.0E-36
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 56 231 2.0E-17
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 45 261 3.0E-11
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 56 227 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 48 500 2.0E-47
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 1 500 1.0E-36
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 56 231 2.0E-17
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 45 261 3.0E-11
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 56 227 6.0E-10
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 64 240 4.0E-09
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 64 224 5.0E-09
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 64 228 6.0E-08
sp|P30986|RETO_ESCCA Reticuline oxidase OS=Eschscholzia californica GN=BBE1 PE=1 SV=1 58 212 6.0E-08
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 72 231 6.0E-08
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 46 223 7.0E-08
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 49 228 1.0E-07
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 38 221 1.0E-07
sp|Q67YU0|CKX5_ARATH Cytokinin dehydrogenase 5 OS=Arabidopsis thaliana GN=CKX5 PE=2 SV=1 64 227 2.0E-07
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 55 228 3.0E-07
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 62 226 4.0E-07
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 46 261 6.0E-07
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 18 228 8.0E-07
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 60 305 1.0E-06
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 27 227 1.0E-06
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 71 212 3.0E-06
sp|Q6Z955|CKX11_ORYSJ Cytokinin dehydrogenase 11 OS=Oryza sativa subsp. japonica GN=CKX11 PE=2 SV=1 47 226 3.0E-06
sp|Q9SVG4|RETOL_ARATH Reticuline oxidase-like protein OS=Arabidopsis thaliana GN=At4g20830 PE=1 SV=2 42 211 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10639
MRSVGFIGLALASAGAAETASQHPAAACCKTLSYSIPYIYHSPVSPEYNSLIKARWSNTAILHPGCVITPRSAQD
VSKALKILAKQHCQFAVKAGGHSATPGFNSIDGGVSIDLTELKSTYMAPDRSSVTLGSGVTWGLAYDTFNDSNIG
FTGGVCEDVGVGGVSIGGGQSLFQAKLGWAVDNIIDYEVVLASGKIVHANQRQHRDLFRALKGGNTNFGIVTRVQ
LAAFELDNLWGGEVFVGLNGPQASRPEMLDKLSRAIVDFVAKNNDDVDTGLQILTAYLSGGKGQTVNSALSNTRG
VENPETVRPFLDMPNRLSNNVRHVKIADFVHELSSFVPKGFRQITASLTITNDYKTLREVWEATDAVYDALPQKD
KIDWVVSIIPQPKVQQSYAKKRGGNSLGLSHVKEDQIVFWFSPRWTDPALDSVMEEVRDKFVEVGERVAKKHGTY
SPFLYINFASPQQDPLCGYGADSVAFLKRTARKYDPKGVFQKLMPGGFKVSKAHCSRRKHSY*
Coding >Hirsu2|10639
ATGAGGTCTGTCGGCTTCATCGGCCTGGCCCTGGCCTCGGCGGGAGCTGCCGAGACGGCGTCCCAGCATCCTGCG
GCAGCCTGCTGCAAAACGCTGTCCTACAGCATTCCCTACATCTACCACAGCCCGGTCTCTCCGGAATACAACAGC
CTGATCAAGGCCCGGTGGTCCAACACGGCCATCCTGCACCCGGGCTGCGTCATCACCCCCCGATCGGCCCAGGAC
GTGTCCAAGGCGCTCAAGATCTTGGCCAAGCAGCATTGCCAGTTCGCCGTCAAGGCCGGCGGGCACTCGGCCACG
CCCGGCTTCAACAGCATCGATGGCGGCGTCTCCATCGACCTCACGGAGCTCAAGTCGACCTACATGGCCCCGGAC
CGCTCCTCCGTCACCCTCGGCTCCGGGGTCACGTGGGGCCTTGCCTACGACACCTTCAACGACAGCAACATCGGC
TTCACCGGCGGCGTCTGCGAGGACGTCGGCGTCGGCGGCGTGTCCATCGGCGGCGGCCAGTCGCTCTTCCAGGCC
AAGCTGGGCTGGGCCGTCGACAACATCATCGACTACGAGGTCGTCCTGGCCTCCGGCAAGATCGTCCACGCCAAC
CAGCGGCAGCACCGGGACCTGTTCCGGGCGCTCAAGGGCGGCAACACCAACTTCGGCATCGTCACCCGCGTCCAG
CTCGCCGCCTTCGAGCTCGACAACCTGTGGGGGGGCGAGGTCTTCGTCGGGCTCAACGGGCCCCAGGCCAGCCGG
CCCGAGATGCTCGACAAGCTCAGCAGGGCCATTGTCGACTTCGTCGCCAAAAACAACGACGACGTCGACACGGGG
CTGCAGATCCTGACGGCCTACCTCAGCGGCGGCAAGGGCCAGACCGTCAACTCGGCCCTCTCCAACACCAGGGGC
GTGGAGAATCCCGAGACCGTCCGGCCATTCCTCGACATGCCCAACCGATTATCGAACAACGTACGCCATGTCAAG
ATCGCCGACTTCGTGCACGAGCTCAGCTCCTTCGTGCCCAAGGGATTCCGCCAAATCACCGCGAGCTTGACCATC
ACCAACGATTACAAGACTCTCCGGGAGGTCTGGGAGGCCACCGACGCCGTGTACGATGCGCTCCCGCAGAAGGAC
AAGATCGACTGGGTGGTCTCCATCATTCCTCAGCCCAAGGTCCAGCAGTCCTACGCCAAGAAGCGGGGCGGCAAC
AGCCTCGGTCTCTCCCACGTCAAGGAAGACCAGATCGTCTTCTGGTTCTCGCCACGCTGGACGGACCCGGCCCTC
GACAGCGTGATGGAAGAGGTGCGGGACAAGTTCGTCGAGGTCGGGGAGAGGGTGGCCAAGAAGCACGGCACCTAC
TCTCCCTTCCTCTACATCAACTTCGCCTCCCCGCAGCAAGACCCTCTCTGCGGCTACGGCGCCGACAGCGTCGCG
TTCCTCAAGAGGACGGCCAGGAAGTACGATCCCAAGGGCGTCTTCCAGAAGCTGATGCCCGGCGGATTCAAAGTC
AGCAAGGCGCACTGTTCACGCAGGAAGCACAGCTATTGA
Transcript >Hirsu2|10639
ATGAGGTCTGTCGGCTTCATCGGCCTGGCCCTGGCCTCGGCGGGAGCTGCCGAGACGGCGTCCCAGCATCCTGCG
GCAGCCTGCTGCAAAACGCTGTCCTACAGCATTCCCTACATCTACCACAGCCCGGTCTCTCCGGAATACAACAGC
CTGATCAAGGCCCGGTGGTCCAACACGGCCATCCTGCACCCGGGCTGCGTCATCACCCCCCGATCGGCCCAGGAC
GTGTCCAAGGCGCTCAAGATCTTGGCCAAGCAGCATTGCCAGTTCGCCGTCAAGGCCGGCGGGCACTCGGCCACG
CCCGGCTTCAACAGCATCGATGGCGGCGTCTCCATCGACCTCACGGAGCTCAAGTCGACCTACATGGCCCCGGAC
CGCTCCTCCGTCACCCTCGGCTCCGGGGTCACGTGGGGCCTTGCCTACGACACCTTCAACGACAGCAACATCGGC
TTCACCGGCGGCGTCTGCGAGGACGTCGGCGTCGGCGGCGTGTCCATCGGCGGCGGCCAGTCGCTCTTCCAGGCC
AAGCTGGGCTGGGCCGTCGACAACATCATCGACTACGAGGTCGTCCTGGCCTCCGGCAAGATCGTCCACGCCAAC
CAGCGGCAGCACCGGGACCTGTTCCGGGCGCTCAAGGGCGGCAACACCAACTTCGGCATCGTCACCCGCGTCCAG
CTCGCCGCCTTCGAGCTCGACAACCTGTGGGGGGGCGAGGTCTTCGTCGGGCTCAACGGGCCCCAGGCCAGCCGG
CCCGAGATGCTCGACAAGCTCAGCAGGGCCATTGTCGACTTCGTCGCCAAAAACAACGACGACGTCGACACGGGG
CTGCAGATCCTGACGGCCTACCTCAGCGGCGGCAAGGGCCAGACCGTCAACTCGGCCCTCTCCAACACCAGGGGC
GTGGAGAATCCCGAGACCGTCCGGCCATTCCTCGACATGCCCAACCGATTATCGAACAACGTACGCCATGTCAAG
ATCGCCGACTTCGTGCACGAGCTCAGCTCCTTCGTGCCCAAGGGATTCCGCCAAATCACCGCGAGCTTGACCATC
ACCAACGATTACAAGACTCTCCGGGAGGTCTGGGAGGCCACCGACGCCGTGTACGATGCGCTCCCGCAGAAGGAC
AAGATCGACTGGGTGGTCTCCATCATTCCTCAGCCCAAGGTCCAGCAGTCCTACGCCAAGAAGCGGGGCGGCAAC
AGCCTCGGTCTCTCCCACGTCAAGGAAGACCAGATCGTCTTCTGGTTCTCGCCACGCTGGACGGACCCGGCCCTC
GACAGCGTGATGGAAGAGGTGCGGGACAAGTTCGTCGAGGTCGGGGAGAGGGTGGCCAAGAAGCACGGCACCTAC
TCTCCCTTCCTCTACATCAACTTCGCCTCCCCGCAGCAAGACCCTCTCTGCGGCTACGGCGCCGACAGCGTCGCG
TTCCTCAAGAGGACGGCCAGGAAGTACGATCCCAAGGGCGTCTTCCAGAAGCTGATGCCCGGCGGATTCAAAGTC
AGCAAGGCGCACTGTTCACGCAGGAAGCACAGCTATTGA
Gene >Hirsu2|10639
ATGAGGTCTGTCGGCTTCATCGGCCTGGCCCTGGCCTCGGCGGGAGCTGCCGAGACGGCGTCCCAGCATCCTGCG
GCAGCCTGCGTAAGCTTGAGCCCTCAACACCAGCGGCCCTATCCGCCAGTCCCCGAATTCACTCCTCCTCCAAGC
TGACACGAGCCTCCCCCCTCCGGCCCCGACGGTCAGTGCAAAACGCTGTCCTACAGCATTCCCTACATCTACCAC
AGCCCGGTCTCTCCGGAATACAACAGCCTGATCAAGGCCCGGTGGTCCAACACGGCCATCCTGCACCCGGGCTGC
GTCATCACCCCCCGATCGGCCCAGGACGTGTCCAAGGCGCTCAAGATCTTGGCCAAGCAGCATTGCCAGTTCGCC
GTCAAGGCCGGCGGGCACTCGGCCACGCCCGGCTTCAACAGCATCGATGGCGGCGTCTCCATCGACCTCACGGAG
CTCAAGTCGACCTACATGGCCCCGGACCGCTCCTCCGTCACCCTCGGCTCCGGGGTCACGTGGGGCCTTGCCTAC
GACACCTTCAACGACAGCAACATCGGCTTCACCGGCGGCGTCTGCGAGGACGTCGGCGTCGGCGGCGTGTCCATC
GGCGGCGGCCAGTCGCTCTTCCAGGCCAAGCTGGGCTGGGCCGTCGACAACATCATCGACTACGAGGTCGTCCTG
GCCTCCGGCAAGATCGTCCACGCCAACCAGCGGCAGCACCGGGACCTGTTCCGGGCGCTCAAGGGCGGCAACACC
AACTTCGGCATCGTCACCCGCGTCCAGCTCGCCGCCTTCGAGCTCGACAACCTGTGGGGGGGCGAGGTCTTCGTC
GGGCTCAACGGGCCCCAGGCCAGCCGGCCCGAGATGCTCGACAAGCTCAGCAGGGCCATTGTCGACTTCGTCGCC
AAAAACAACGACGACGTCGACACGGGGCTGCAGATCCTGACGGCCTACCTCAGCGGCGGCAAGGGCCAGACCGTC
AACTCGGCCCTCTCCAACACCAGGGGCGTGGAGAATCCCGAGACCGTCCGGCCATTCCTCGACATGCCCAACCGA
TTATCGAACAACGTACGCCATGTCAAGATCGCCGACTTCGTGCACGAGCTCAGCTCCTTCGTGCCCAAGGGATTC
CGGTAAGCGCAGAAGCCGTGTCGTCTGGTCTCTCCCGCCTGTTGTCCTGACAAGCTTGGCAGCCAAATCACCGCG
AGCTTGACCATCACCAACGATTACAAGACTCTCCGGGAGGTCTGGGAGGCCACCGACGCCGTGTACGATGCGCTC
CCGCAGAAGGACAAGATCGACTGGGTGGTCTCCATCATTCCTCAGCCCAAGGTCCAGCAGTCCTACGCCAAGAAG
CGGGGCGGCAACAGCCTCGGTCTCTCCCACGTCAAGGAAGACCAGATCGGTGAGTGGCGAACCCCCCGTACGGAG
CCGGCCGGGCCTGGCCGCTGTCCCCGCTGACCGGACGTCTCCCTGCAGTCTTCTGGTTCTCGCCACGCTGGACGG
ACCCGGCCCTCGACAGCGTGATGGAAGAGGTGCGGGACAAGTTCGTCGAGGTCGGGGAGAGGGTGGCCAAGAAGC
ACGGCACCTACTCTCCCTTCCTCTACATCAACTTCGCCTCCCCGCAGCAAGACCCTCTCTGCGGCTACGGCGCCG
ACAGCGTCGCGTTCCTCAAGAGGACGGCCAGGAAGTACGATCCCAAGGGCGTCTTCCAGAAGCTGATGCCCGGCG
GATTCAAAGTCAGCAAGGCGCACTGTTCACGCAGGAAGCACAGCTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail