Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10635
Gene name
LocationContig_88:24929..25994
Strand-
Gene length (bp)1065
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 7.0E-20 10 200
PF01370 Epimerase NAD dependent epimerase/dehydratase family 9.0E-06 45 131

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 13 204 1.0E-09
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 13 204 5.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10635
MERGDGAVQTSDRVVCLPCDLASKTLGLSEEDRQGVLHEATVFIHSAWAVNFNIRLESFEDQIAGTRSLIEAAAE
SCAPLFFISSTAAVSRTASPTVFETVSEDISDASPLGYAQSKWVAERVCAAANDRFSRAASSPDPARPGRVSIIR
VGQLCGDEAGVWNASEAYPLLLSTAAIAGCLPSIAGEALDWMPVELAARSVLEIVSAGRAGTRLNGSDSRSYEDG
EPDGGPSAQTRVYHVLNPHKSPTWEHMLHWLSADPGGRPFQVVSPATWLARLEAALDGRKPSHPSEALLGLWRDK
FGQEPDGKAAAGATRVPVFSVALAQDVSPTMRGLKPLGRQRLAEMWKWVCGNVG*
Coding >Hirsu2|10635
ATGGAGCGCGGAGACGGGGCGGTGCAGACGAGCGACAGGGTCGTGTGCCTGCCGTGCGATCTGGCGAGCAAGACG
CTGGGCCTGTCCGAGGAAGACAGACAAGGCGTGCTGCACGAGGCCACCGTCTTCATCCACTCAGCCTGGGCCGTC
AATTTCAACATCCGCCTCGAGTCGTTCGAAGACCAGATCGCCGGGACGCGGAGCTTGATCGAGGCGGCCGCGGAA
AGCTGTGCGCCGCTGTTCTTCATCAGCTCGACCGCTGCGGTGAGCCGGACGGCGTCCCCGACCGTGTTCGAGACG
GTGTCTGAGGACATATCGGACGCGTCGCCCCTGGGCTACGCTCAGTCGAAATGGGTGGCCGAACGAGTCTGCGCC
GCGGCAAACGACCGCTTCAGCAGGGCCGCGTCGTCTCCCGATCCCGCCCGCCCCGGCCGCGTATCCATCATCCGG
GTCGGCCAGCTGTGCGGCGACGAGGCCGGTGTGTGGAACGCCAGCGAGGCCTATCCGCTTCTGCTGTCGACGGCG
GCCATCGCCGGCTGCCTGCCCAGCATTGCTGGCGAGGCGCTCGACTGGATGCCGGTAGAGCTCGCCGCGCGGTCT
GTCTTGGAGATTGTCTCCGCGGGCCGGGCCGGAACGAGGCTCAACGGATCCGACTCCCGCTCCTATGAAGACGGC
GAGCCAGACGGGGGCCCGTCGGCGCAAACGCGCGTCTACCACGTCTTGAACCCGCACAAGTCTCCGACCTGGGAG
CACATGCTCCACTGGCTGTCAGCCGATCCCGGAGGTCGTCCGTTCCAGGTCGTGTCGCCCGCAACATGGCTTGCA
CGGCTGGAGGCCGCACTGGACGGGAGAAAGCCGAGCCACCCGTCCGAGGCTCTGCTCGGCCTATGGAGAGACAAG
TTCGGCCAGGAGCCGGACGGCAAGGCTGCGGCGGGAGCGACGCGTGTTCCCGTATTCAGCGTCGCCCTGGCGCAG
GACGTCTCGCCGACGATGCGTGGGCTGAAGCCGCTTGGCCGCCAGAGGCTGGCCGAGATGTGGAAGTGGGTGTGC
GGAAATGTTGGATGA
Transcript >Hirsu2|10635
ATGGAGCGCGGAGACGGGGCGGTGCAGACGAGCGACAGGGTCGTGTGCCTGCCGTGCGATCTGGCGAGCAAGACG
CTGGGCCTGTCCGAGGAAGACAGACAAGGCGTGCTGCACGAGGCCACCGTCTTCATCCACTCAGCCTGGGCCGTC
AATTTCAACATCCGCCTCGAGTCGTTCGAAGACCAGATCGCCGGGACGCGGAGCTTGATCGAGGCGGCCGCGGAA
AGCTGTGCGCCGCTGTTCTTCATCAGCTCGACCGCTGCGGTGAGCCGGACGGCGTCCCCGACCGTGTTCGAGACG
GTGTCTGAGGACATATCGGACGCGTCGCCCCTGGGCTACGCTCAGTCGAAATGGGTGGCCGAACGAGTCTGCGCC
GCGGCAAACGACCGCTTCAGCAGGGCCGCGTCGTCTCCCGATCCCGCCCGCCCCGGCCGCGTATCCATCATCCGG
GTCGGCCAGCTGTGCGGCGACGAGGCCGGTGTGTGGAACGCCAGCGAGGCCTATCCGCTTCTGCTGTCGACGGCG
GCCATCGCCGGCTGCCTGCCCAGCATTGCTGGCGAGGCGCTCGACTGGATGCCGGTAGAGCTCGCCGCGCGGTCT
GTCTTGGAGATTGTCTCCGCGGGCCGGGCCGGAACGAGGCTCAACGGATCCGACTCCCGCTCCTATGAAGACGGC
GAGCCAGACGGGGGCCCGTCGGCGCAAACGCGCGTCTACCACGTCTTGAACCCGCACAAGTCTCCGACCTGGGAG
CACATGCTCCACTGGCTGTCAGCCGATCCCGGAGGTCGTCCGTTCCAGGTCGTGTCGCCCGCAACATGGCTTGCA
CGGCTGGAGGCCGCACTGGACGGGAGAAAGCCGAGCCACCCGTCCGAGGCTCTGCTCGGCCTATGGAGAGACAAG
TTCGGCCAGGAGCCGGACGGCAAGGCTGCGGCGGGAGCGACGCGTGTTCCCGTATTCAGCGTCGCCCTGGCGCAG
GACGTCTCGCCGACGATGCGTGGGCTGAAGCCGCTTGGCCGCCAGAGGCTGGCCGAGATGTGGAAGTGGGTGTGC
GGAAATGTTGGATGA
Gene >Hirsu2|10635
ATGGAGCGCGGAGACGGGGCGGTGCAGACGAGCGACAGGGTCGTGTGCCTGCCGTGCGATCTGGCGAGCAAGACG
CTGGGCCTGTCCGAGGAAGACAGACAAGGCGTGCTGCACGAGGCCACCGTCTTCATCCACTCAGCCTGGGCCGTC
AATTTCAACATCCGCCTCGAGTCGTTCGAAGACCAGATCGCCGGGACGCGGAGCTTGATCGAGGCGGCCGCGGAA
AGCTGTGCGCCGCTGTTCTTCATCAGCTCGACCGCTGCGGTGAGCCGGACGGCGTCCCCGACCGTGTTCGAGACG
GTGTCTGAGGACATATCGGACGCGTCGCCCCTGGGCTACGCTCAGTCGAAATGGGTGGCCGAACGAGTCTGCGCC
GCGGCAAACGACCGCTTCAGCAGGGCCGCGTCGTCTCCCGATCCCGCCCGCCCCGGCCGCGTATCCATCATCCGG
GTCGGCCAGCTGTGCGGCGACGAGGCCGGTGTGTGGAACGCCAGCGAGGCCTATCCGCTTCTGCTGTCGACGGCG
GCCATCGCCGGCTGCCTGCCCAGCATTGCTGGCGAGGCGCTCGACTGGATGCCGGTAGAGCTCGCCGCGCGGTCT
GTCTTGGAGATTGTCTCCGCGGGCCGGGCCGGAACGAGGCTCAACGGATCCGACTCCCGCTCCTATGAAGACGGC
GAGCCAGACGGGGGCCCGTCGGCGCAAACGCGCGTCTACCACGTCTTGAACCCGCACAAGTCTCCGACCTGGGAG
CACATGCTCCACTGGCTGTCAGCCGATCCCGGAGGTCGTCCGTTCCAGGTCGTGTCGCCCGCAACATGGCTTGCA
CGGCTGGAGGCCGCACTGGACGGGAGAAAGCCGAGCCACCCGTCCGAGGCTCTGCTCGGCCTATGGAGAGACAAG
TTCGGCCAGGAGCCGGACGGCAAGGCTGCGGCGGGAGCGACGCGTGTTCCCGTATTCAGCGTCGCCCTGGCGCAG
GACGTCTCGCCGACGATGCGTGGGCTGAAGCCGCTTGGCCGCCAGAGGCTGGCCGAGATGTGGAAGTGGGTGTGC
GGAAATGTTGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail