Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10633
Gene name
LocationContig_88:19041..20103
Strand-
Gene length (bp)1062
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 9.7E-24 6 252
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 1.6E-17 7 255
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 1.8E-12 7 201
PF13460 NAD_binding_10 NAD(P)H-binding 6.8E-11 10 174
PF05368 NmrA NmrA-like family 8.6E-09 6 132
PF07993 NAD_binding_4 Male sterility protein 2.4E-09 8 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT59|YKJ7_SCHPO Putative uncharacterized oxidoreductase C513.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC513.07 PE=3 SV=1 1 307 7.0E-42
sp|P83775|GRP2_CANAL Putative NADPH-dependent methylglyoxal reductase GRP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GRP2 PE=1 SV=2 5 283 3.0E-41
sp|Q9CA28|TKPR2_ARATH Tetraketide alpha-pyrone reductase 2 OS=Arabidopsis thaliana GN=TKPR2 PE=1 SV=1 7 253 1.0E-32
sp|P53111|ARI1_YEAST NADPH-dependent aldehyde reductase ARI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARI1 PE=1 SV=1 2 345 8.0E-31
sp|Q12068|GRE2_YEAST NADPH-dependent methylglyoxal reductase GRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRE2 PE=1 SV=1 5 278 2.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT59|YKJ7_SCHPO Putative uncharacterized oxidoreductase C513.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC513.07 PE=3 SV=1 1 307 7.0E-42
sp|P83775|GRP2_CANAL Putative NADPH-dependent methylglyoxal reductase GRP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GRP2 PE=1 SV=2 5 283 3.0E-41
sp|Q9CA28|TKPR2_ARATH Tetraketide alpha-pyrone reductase 2 OS=Arabidopsis thaliana GN=TKPR2 PE=1 SV=1 7 253 1.0E-32
sp|P53111|ARI1_YEAST NADPH-dependent aldehyde reductase ARI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARI1 PE=1 SV=1 2 345 8.0E-31
sp|Q12068|GRE2_YEAST NADPH-dependent methylglyoxal reductase GRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRE2 PE=1 SV=1 5 278 2.0E-30
sp|Q500U8|TKPR1_ARATH Tetraketide alpha-pyrone reductase 1 OS=Arabidopsis thaliana GN=TKPR1 PE=1 SV=1 6 304 3.0E-30
sp|P51106|DFRA_HORVU Dihydroflavonol-4-reductase OS=Hordeum vulgare GN=ANT18 PE=3 SV=1 6 292 3.0E-29
sp|P53183|YGD9_YEAST Putative uncharacterized oxidoreductase YGL039W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL039W PE=1 SV=1 6 260 2.0E-28
sp|Q9S9N9|CCR1_ARATH Cinnamoyl-CoA reductase 1 OS=Arabidopsis thaliana GN=CCR1 PE=1 SV=1 3 259 2.0E-28
sp|P51108|DFRA_MAIZE Dihydroflavonol-4-reductase OS=Zea mays GN=A1 PE=3 SV=1 5 292 5.0E-28
sp|P51102|DFRA_ARATH Dihydroflavonol-4-reductase OS=Arabidopsis thaliana GN=DFRA PE=1 SV=2 4 280 7.0E-28
sp|P51110|DFRA_VITVI Dihydroflavonol-4-reductase OS=Vitis vinifera GN=DFR PE=1 SV=1 4 287 7.0E-28
sp|Q9XES5|DFRA_MALDO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Malus domestica GN=DFR PE=1 SV=1 4 287 1.0E-27
sp|Q84KP0|DFRA_PYRCO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Pyrus communis GN=DFR PE=1 SV=1 4 287 5.0E-27
sp|P51105|DFRA_GERHY Dihydroflavonol-4-reductase OS=Gerbera hybrida GN=DFR PE=2 SV=1 5 264 1.0E-26
sp|P73212|DFRA_SYNY3 Putative dihydroflavonol-4-reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dfrA PE=3 SV=1 5 352 1.0E-26
sp|Q03049|YD541_YEAST Putative uncharacterized oxidoreductase YDR541C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR541C PE=3 SV=2 4 278 5.0E-26
sp|Q9SAH9|CCR2_ARATH Cinnamoyl-CoA reductase 2 OS=Arabidopsis thaliana GN=CCR2 PE=1 SV=1 3 257 1.0E-25
sp|Q9SEV0|BAN_ARATH Anthocyanidin reductase OS=Arabidopsis thaliana GN=BAN PE=1 SV=2 4 280 5.0E-25
sp|P51103|DFRA_CALCH Dihydroflavonol-4-reductase OS=Callistephus chinensis GN=F PE=2 SV=1 5 288 2.0E-23
sp|P51107|DFRA_SOLLC Dihydroflavonol-4-reductase OS=Solanum lycopersicum PE=2 SV=1 5 287 8.0E-23
sp|P14720|DFRA_PETHY Dihydroflavonol-4-reductase OS=Petunia hybrida GN=DFRA PE=2 SV=2 5 287 1.0E-22
sp|Q40316|VESTR_MEDSA Vestitone reductase OS=Medicago sativa PE=1 SV=1 6 255 1.0E-22
sp|P51104|DFRA_DIACA Dihydroflavonol-4-reductase OS=Dianthus caryophyllus GN=A PE=2 SV=1 3 287 2.0E-22
sp|O22133|BEN1_ARATH Protein BRI1-5 ENHANCED 1 OS=Arabidopsis thaliana GN=BEN1 PE=2 SV=1 6 281 4.0E-20
sp|P14721|DFRA_ANTMA Dihydroflavonol-4-reductase OS=Antirrhinum majus GN=DFRA PE=2 SV=1 5 280 4.0E-19
sp|Q9UUN9|ALD2_SPOSA Aldehyde reductase 2 OS=Sporidiobolus salmonicolor PE=1 SV=3 3 286 5.0E-19
sp|P51109|DFRA_MEDSA Dihydroflavonol-4-reductase (Fragment) OS=Medicago sativa GN=DFR1 PE=2 SV=1 16 202 2.0E-17
sp|O94563|YGD4_SCHPO Putative uncharacterized oxidoreductase C1773.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.04 PE=1 SV=1 6 247 8.0E-17
sp|Q9SUN3|ARAE3_ARATH Probable UDP-arabinose 4-epimerase 3 OS=Arabidopsis thaliana GN=At4g20460 PE=2 SV=3 6 246 2.0E-10
sp|Q8H930|ARAE1_ORYSJ Probable UDP-arabinose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UEL-1 PE=2 SV=2 6 249 2.0E-09
sp|Q8H0B6|ARAE2_ORYSJ Probable UDP-arabinose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UEL-2 PE=2 SV=1 6 246 1.0E-08
sp|Q9FI17|ARAE4_ARATH Putative UDP-arabinose 4-epimerase 4 OS=Arabidopsis thaliana GN=At5g44480 PE=3 SV=1 6 246 1.0E-08
sp|Q9R1J0|NSDHL_MOUSE Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Mus musculus GN=Nsdhl PE=1 SV=1 3 348 2.0E-08
sp|Q4R7R1|D42E1_MACFA Short-chain dehydrogenase/reductase family 42E member 1 OS=Macaca fascicularis GN=SDR42E1 PE=2 SV=1 4 338 4.0E-08
sp|Q15738|NSDHL_HUMAN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens GN=NSDHL PE=1 SV=2 3 352 6.0E-08
sp|Q0IH73|D42E1_XENLA Short-chain dehydrogenase/reductase family 42E member 1 OS=Xenopus laevis GN=sdr42e1 PE=2 SV=1 4 332 7.0E-08
sp|O64749|ARAE2_ARATH Putative UDP-arabinose 4-epimerase 2 OS=Arabidopsis thaliana GN=At2g34850 PE=2 SV=3 6 246 7.0E-08
sp|Q9SA77|ARAE1_ARATH UDP-arabinose 4-epimerase 1 OS=Arabidopsis thaliana GN=MUR4 PE=1 SV=1 6 246 9.0E-08
sp|Q9N119|3BHS_PIG 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Sus scrofa GN=HSD3B PE=2 SV=4 1 331 1.0E-07
sp|Q5PPL3|NSDHL_RAT Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Rattus norvegicus GN=Nsdhl PE=2 SV=1 3 200 2.0E-07
sp|Q32L94|D42E1_BOVIN Short-chain dehydrogenase/reductase family 42E member 1 OS=Bos taurus GN=SDR42E1 PE=2 SV=2 4 338 2.0E-07
sp|P22715|GALE_SALTY UDP-glucose 4-epimerase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galE PE=3 SV=2 6 246 3.0E-07
sp|Q54L85|NSDHL_DICDI Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Dictyostelium discoideum GN=nsdhl PE=3 SV=1 4 174 6.0E-07
sp|Q56093|GALE_SALTI UDP-glucose 4-epimerase OS=Salmonella typhi GN=galE PE=3 SV=2 6 174 7.0E-07
sp|Q6DF08|UXS1_XENTR UDP-glucuronic acid decarboxylase 1 OS=Xenopus tropicalis GN=uxs1 PE=2 SV=1 4 202 8.0E-07
sp|Q5R885|UXS1_PONAB UDP-glucuronic acid decarboxylase 1 OS=Pongo abelii GN=UXS1 PE=2 SV=1 4 202 1.0E-06
sp|Q8NBZ7|UXS1_HUMAN UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens GN=UXS1 PE=1 SV=1 4 202 1.0E-06
sp|P09147|GALE_ECOLI UDP-glucose 4-epimerase OS=Escherichia coli (strain K12) GN=galE PE=1 SV=1 6 174 1.0E-06
sp|Q5PQX0|UXS1_RAT UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus GN=Uxs1 PE=1 SV=1 4 202 1.0E-06
sp|Q91XL3|UXS1_MOUSE UDP-glucuronic acid decarboxylase 1 OS=Mus musculus GN=Uxs1 PE=1 SV=1 4 202 1.0E-06
sp|Q5IFP1|3BHS_CANLF 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Canis lupus familiaris GN=HSD3B PE=2 SV=3 1 331 1.0E-06
sp|Q6K2E1|UGE4_ORYSJ UDP-glucose 4-epimerase 4 OS=Oryza sativa subsp. japonica GN=UGE-4 PE=2 SV=1 2 174 4.0E-06
sp|Q6GMI9|UXS1_DANRE UDP-glucuronic acid decarboxylase 1 OS=Danio rerio GN=uxs1 PE=2 SV=2 4 192 4.0E-06
sp|P55180|GALE_BACSU UDP-glucose 4-epimerase OS=Bacillus subtilis (strain 168) GN=galE PE=3 SV=1 6 174 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0055114 oxidation-reduction process Yes
GO:0006694 steroid biosynthetic process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0050662 coenzyme binding Yes
GO:0008202 steroid metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003674 molecular_function No
GO:0008610 lipid biosynthetic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0016229 steroid dehydrogenase activity No
GO:0009058 biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0048037 cofactor binding No
GO:0016491 oxidoreductase activity No
GO:1901576 organic substance biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10633
MTGKTVLVTGGSGFIGSHVIVHALQKGYHVRTTVRSLSRSDSVREKLLNGGISEEQARGVQFFEVDLLGDKGWDD
ACKGCDFVLHVASPYPLGVPKDEQEVIRPAREGTLRALRAAKRAGTVKRIVITSSFAAIGYGHEPRTKENPLTEK
DWTVLKSPKSPVGAYEKSKTLAEQDAWQWLKNEGSGMELATVNPVSVWGPSLGREENTSLELATRMLNGQLPGLP
NLAFGIVDVRDVADLHIKAMEAPEAAGQRYLAISDELSVSTSDISTYLKQGLPAHESRRVPTHVLPNFLLRLAGH
FDKSVALIVPELGIVRPTSNEKARRELSWKPRSARDAVISSPESLKRTGRVKL*
Coding >Hirsu2|10633
ATGACGGGAAAGACTGTCCTCGTTACGGGCGGGTCTGGTTTCATCGGCTCTCACGTCATCGTCCACGCGCTCCAG
AAAGGTTACCATGTCCGAACGACGGTGCGGTCTCTGAGCCGCTCCGACTCTGTGCGAGAAAAGCTCCTCAACGGC
GGCATATCCGAGGAACAGGCCCGCGGTGTCCAATTTTTCGAAGTTGACCTCCTGGGTGACAAGGGCTGGGACGAC
GCCTGCAAAGGCTGCGACTTTGTGCTCCACGTTGCGTCCCCCTATCCGCTGGGGGTGCCCAAAGACGAACAAGAG
GTCATCCGACCAGCCCGAGAAGGGACCCTCAGAGCATTGCGAGCCGCAAAAAGGGCGGGGACCGTCAAGCGGATC
GTCATCACATCGTCCTTCGCGGCCATCGGCTACGGCCACGAACCGAGGACCAAGGAAAACCCGCTGACCGAAAAG
GACTGGACTGTGCTCAAGAGCCCCAAGAGCCCGGTGGGGGCTTACGAGAAGAGCAAGACACTGGCCGAGCAAGAC
GCGTGGCAATGGCTCAAGAACGAGGGGTCGGGGATGGAGCTGGCGACGGTCAATCCCGTCAGCGTCTGGGGCCCT
TCCCTCGGCAGAGAAGAGAATACCAGTCTGGAGCTGGCGACGCGGATGCTGAACGGACAGCTTCCTGGCCTGCCC
AACCTCGCCTTCGGCATCGTCGACGTCAGGGATGTCGCCGACCTTCACATCAAGGCGATGGAGGCCCCCGAAGCT
GCCGGTCAGCGATACCTGGCCATCTCCGACGAGCTTTCGGTGTCGACAAGCGACATCTCGACGTACTTGAAGCAG
GGGCTCCCTGCACACGAGTCGAGGAGAGTGCCTACTCACGTGCTGCCGAACTTTCTCCTACGCCTCGCCGGGCAC
TTTGACAAGTCTGTTGCACTGATCGTGCCGGAGCTGGGAATCGTCAGGCCTACTAGCAATGAGAAAGCTCGGAGA
GAGCTGAGTTGGAAGCCTCGCAGCGCGCGAGATGCCGTCATCAGCAGCCCCGAGAGCTTGAAGAGGACGGGAAGG
GTCAAGCTCTAG
Transcript >Hirsu2|10633
ATGACGGGAAAGACTGTCCTCGTTACGGGCGGGTCTGGTTTCATCGGCTCTCACGTCATCGTCCACGCGCTCCAG
AAAGGTTACCATGTCCGAACGACGGTGCGGTCTCTGAGCCGCTCCGACTCTGTGCGAGAAAAGCTCCTCAACGGC
GGCATATCCGAGGAACAGGCCCGCGGTGTCCAATTTTTCGAAGTTGACCTCCTGGGTGACAAGGGCTGGGACGAC
GCCTGCAAAGGCTGCGACTTTGTGCTCCACGTTGCGTCCCCCTATCCGCTGGGGGTGCCCAAAGACGAACAAGAG
GTCATCCGACCAGCCCGAGAAGGGACCCTCAGAGCATTGCGAGCCGCAAAAAGGGCGGGGACCGTCAAGCGGATC
GTCATCACATCGTCCTTCGCGGCCATCGGCTACGGCCACGAACCGAGGACCAAGGAAAACCCGCTGACCGAAAAG
GACTGGACTGTGCTCAAGAGCCCCAAGAGCCCGGTGGGGGCTTACGAGAAGAGCAAGACACTGGCCGAGCAAGAC
GCGTGGCAATGGCTCAAGAACGAGGGGTCGGGGATGGAGCTGGCGACGGTCAATCCCGTCAGCGTCTGGGGCCCT
TCCCTCGGCAGAGAAGAGAATACCAGTCTGGAGCTGGCGACGCGGATGCTGAACGGACAGCTTCCTGGCCTGCCC
AACCTCGCCTTCGGCATCGTCGACGTCAGGGATGTCGCCGACCTTCACATCAAGGCGATGGAGGCCCCCGAAGCT
GCCGGTCAGCGATACCTGGCCATCTCCGACGAGCTTTCGGTGTCGACAAGCGACATCTCGACGTACTTGAAGCAG
GGGCTCCCTGCACACGAGTCGAGGAGAGTGCCTACTCACGTGCTGCCGAACTTTCTCCTACGCCTCGCCGGGCAC
TTTGACAAGTCTGTTGCACTGATCGTGCCGGAGCTGGGAATCGTCAGGCCTACTAGCAATGAGAAAGCTCGGAGA
GAGCTGAGTTGGAAGCCTCGCAGCGCGCGAGATGCCGTCATCAGCAGCCCCGAGAGCTTGAAGAGGACGGGAAGG
GTCAAGCTCTAG
Gene >Hirsu2|10633
ATGACGGGAAAGACTGTCCTCGTTACGGGCGGGTCTGGTTTCATCGGCTCTCACGTCATCGTCCACGCGCTCCAG
AAAGGTTACCATGTCCGAACGACGGTGCGGTCTCTGAGCCGCTCCGACTCTGTGCGAGAAAAGCTCCTCAACGGC
GGCATATCCGAGGAACAGGCCCGCGGTGTCCAATTTTTCGAAGTTGACCTCCTGGGTGACAAGGGCTGGGACGAC
GCCTGCAAAGGCTGCGACTTTGTGCTCCACGTTGCGTCCCCCTATCCGCTGGGGGTGCCCAAAGACGAACAAGAG
GTCATCCGACCAGCCCGAGAAGGGACCCTCAGAGCATTGCGAGCCGCAAAAAGGGCGGGGACCGTCAAGCGGATC
GTCATCACATCGTCCTTCGCGGCCATCGGCTACGGCCACGAACCGAGGACCAAGGAAAACCCGCTGACCGAAAAG
GACTGGACTGTGCTCAAGAGCCCCAAGAGCCCGGTGGGGGCTTACGAGAAGAGCAAGACACTGGCCGAGCAAGAC
GCGTGGCAATGGCTCAAGAACGAGGGGTCGGGGATGGAGCTGGCGACGGTCAATCCCGTCAGCGTCTGGGGCCCT
TCCCTCGGCAGAGAAGAGAATACCAGTCTGGAGCTGGCGACGCGGATGCTGAACGGACAGCTTCCTGGCCTGCCC
AACCTCGCCTTCGGCATCGTCGACGTCAGGGATGTCGCCGACCTTCACATCAAGGCGATGGAGGCCCCCGAAGCT
GCCGGTCAGCGATACCTGGCCATCTCCGACGAGCTTTCGGTGTCGACAAGCGACATCTCGACGTACTTGAAGCAG
GGGCTCCCTGCACACGAGTCGAGGAGAGTGCCTACTCACGTGCTGCCGAACTTTCTCCTACGCCTCGCCGGGCAC
TTTGACAAGTCTGTTGCACTGATCGTGCCGGAGCTGGGAATCGTCAGGCCTACTAGCAATGAGAAAGCTCGGAGA
GAGCTGAGTTGGAAGCCTCGCAGCGCGCGAGATGCCGTCATCAGCAGCCCCGAGAGCTTGAAGAGGACGGGAAGG
GTCAAGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail