Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|10633
Gene name
LocationContig_88:19041..20103
Strand-
Gene length (bp)1062
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.1E-23 6 252
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 1.8E-17 7 255
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 7.0E-13 7 202
PF13460 NAD_binding_10 NAD(P)H-binding 8.9E-11 10 141
PF05368 NmrA NmrA-like family 4.9E-08 6 132
PF07993 NAD_binding_4 Male sterility protein 3.3E-09 8 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT59|YKJ7_SCHPO Putative uncharacterized oxidoreductase C513.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC513.07 PE=3 SV=1 1 307 7.0E-42
sp|P83775|GRP2_CANAL Putative NADPH-dependent methylglyoxal reductase GRP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GRP2 PE=1 SV=2 5 283 3.0E-41
sp|Q9CA28|TKPR2_ARATH Tetraketide alpha-pyrone reductase 2 OS=Arabidopsis thaliana GN=TKPR2 PE=1 SV=1 7 253 1.0E-32
sp|P53111|ARI1_YEAST NADPH-dependent aldehyde reductase ARI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARI1 PE=1 SV=1 2 345 8.0E-31
sp|Q12068|GRE2_YEAST NADPH-dependent methylglyoxal reductase GRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRE2 PE=1 SV=1 5 278 2.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT59|YKJ7_SCHPO Putative uncharacterized oxidoreductase C513.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC513.07 PE=3 SV=1 1 307 7.0E-42
sp|P83775|GRP2_CANAL Putative NADPH-dependent methylglyoxal reductase GRP2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GRP2 PE=1 SV=2 5 283 3.0E-41
sp|Q9CA28|TKPR2_ARATH Tetraketide alpha-pyrone reductase 2 OS=Arabidopsis thaliana GN=TKPR2 PE=1 SV=1 7 253 1.0E-32
sp|P53111|ARI1_YEAST NADPH-dependent aldehyde reductase ARI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARI1 PE=1 SV=1 2 345 8.0E-31
sp|Q12068|GRE2_YEAST NADPH-dependent methylglyoxal reductase GRE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRE2 PE=1 SV=1 5 278 2.0E-30
sp|Q500U8|TKPR1_ARATH Tetraketide alpha-pyrone reductase 1 OS=Arabidopsis thaliana GN=TKPR1 PE=1 SV=1 6 304 3.0E-30
sp|P51106|DFRA_HORVU Dihydroflavonol-4-reductase OS=Hordeum vulgare GN=ANT18 PE=3 SV=1 6 292 3.0E-29
sp|P53183|YGD9_YEAST Putative uncharacterized oxidoreductase YGL039W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL039W PE=1 SV=1 6 260 2.0E-28
sp|Q9S9N9|CCR1_ARATH Cinnamoyl-CoA reductase 1 OS=Arabidopsis thaliana GN=CCR1 PE=1 SV=1 3 259 2.0E-28
sp|P51108|DFRA_MAIZE Dihydroflavonol-4-reductase OS=Zea mays GN=A1 PE=3 SV=1 5 292 5.0E-28
sp|P51102|DFRA_ARATH Dihydroflavonol-4-reductase OS=Arabidopsis thaliana GN=DFRA PE=1 SV=2 4 280 7.0E-28
sp|P51110|DFRA_VITVI Dihydroflavonol-4-reductase OS=Vitis vinifera GN=DFR PE=1 SV=1 4 287 7.0E-28
sp|Q9XES5|DFRA_MALDO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Malus domestica GN=DFR PE=1 SV=1 4 287 1.0E-27
sp|Q84KP0|DFRA_PYRCO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Pyrus communis GN=DFR PE=1 SV=1 4 287 5.0E-27
sp|P51105|DFRA_GERHY Dihydroflavonol-4-reductase OS=Gerbera hybrida GN=DFR PE=2 SV=1 5 264 1.0E-26
sp|P73212|DFRA_SYNY3 Putative dihydroflavonol-4-reductase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dfrA PE=3 SV=1 5 352 1.0E-26
sp|Q03049|YD541_YEAST Putative uncharacterized oxidoreductase YDR541C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR541C PE=3 SV=2 4 278 5.0E-26
sp|Q9SAH9|CCR2_ARATH Cinnamoyl-CoA reductase 2 OS=Arabidopsis thaliana GN=CCR2 PE=1 SV=1 3 257 1.0E-25
sp|Q9SEV0|BAN_ARATH Anthocyanidin reductase OS=Arabidopsis thaliana GN=BAN PE=1 SV=2 4 280 5.0E-25
sp|P51103|DFRA_CALCH Dihydroflavonol-4-reductase OS=Callistephus chinensis GN=F PE=2 SV=1 5 288 2.0E-23
sp|P51107|DFRA_SOLLC Dihydroflavonol-4-reductase OS=Solanum lycopersicum PE=2 SV=1 5 287 8.0E-23
sp|P14720|DFRA_PETHY Dihydroflavonol-4-reductase OS=Petunia hybrida GN=DFRA PE=2 SV=2 5 287 1.0E-22
sp|Q40316|VESTR_MEDSA Vestitone reductase OS=Medicago sativa PE=1 SV=1 6 255 1.0E-22
sp|P51104|DFRA_DIACA Dihydroflavonol-4-reductase OS=Dianthus caryophyllus GN=A PE=2 SV=1 3 287 2.0E-22
sp|O22133|BEN1_ARATH Protein BRI1-5 ENHANCED 1 OS=Arabidopsis thaliana GN=BEN1 PE=2 SV=1 6 281 4.0E-20
sp|P14721|DFRA_ANTMA Dihydroflavonol-4-reductase OS=Antirrhinum majus GN=DFRA PE=2 SV=1 5 280 4.0E-19
sp|Q9UUN9|ALD2_SPOSA Aldehyde reductase 2 OS=Sporidiobolus salmonicolor PE=1 SV=3 3 286 5.0E-19
sp|P51109|DFRA_MEDSA Dihydroflavonol-4-reductase (Fragment) OS=Medicago sativa GN=DFR1 PE=2 SV=1 16 202 2.0E-17
sp|O94563|YGD4_SCHPO Putative uncharacterized oxidoreductase C1773.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.04 PE=1 SV=1 6 247 8.0E-17
sp|Q9SUN3|ARAE3_ARATH Probable UDP-arabinose 4-epimerase 3 OS=Arabidopsis thaliana GN=At4g20460 PE=2 SV=3 6 246 2.0E-10
sp|Q8H930|ARAE1_ORYSJ Probable UDP-arabinose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UEL-1 PE=2 SV=2 6 249 2.0E-09
sp|Q8H0B6|ARAE2_ORYSJ Probable UDP-arabinose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UEL-2 PE=2 SV=1 6 246 1.0E-08
sp|Q9FI17|ARAE4_ARATH Putative UDP-arabinose 4-epimerase 4 OS=Arabidopsis thaliana GN=At5g44480 PE=3 SV=1 6 246 1.0E-08
sp|Q9R1J0|NSDHL_MOUSE Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Mus musculus GN=Nsdhl PE=1 SV=1 3 348 2.0E-08
sp|Q4R7R1|D42E1_MACFA Short-chain dehydrogenase/reductase family 42E member 1 OS=Macaca fascicularis GN=SDR42E1 PE=2 SV=1 4 338 4.0E-08
sp|Q15738|NSDHL_HUMAN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens GN=NSDHL PE=1 SV=2 3 352 6.0E-08
sp|Q0IH73|D42E1_XENLA Short-chain dehydrogenase/reductase family 42E member 1 OS=Xenopus laevis GN=sdr42e1 PE=2 SV=1 4 332 7.0E-08
sp|O64749|ARAE2_ARATH Putative UDP-arabinose 4-epimerase 2 OS=Arabidopsis thaliana GN=At2g34850 PE=2 SV=3 6 246 7.0E-08
sp|Q9SA77|ARAE1_ARATH UDP-arabinose 4-epimerase 1 OS=Arabidopsis thaliana GN=MUR4 PE=1 SV=1 6 246 9.0E-08
sp|Q9N119|3BHS_PIG 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Sus scrofa GN=HSD3B PE=2 SV=4 1 331 1.0E-07
sp|Q5PPL3|NSDHL_RAT Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Rattus norvegicus GN=Nsdhl PE=2 SV=1 3 200 2.0E-07
sp|Q32L94|D42E1_BOVIN Short-chain dehydrogenase/reductase family 42E member 1 OS=Bos taurus GN=SDR42E1 PE=2 SV=2 4 338 2.0E-07
sp|P22715|GALE_SALTY UDP-glucose 4-epimerase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galE PE=3 SV=2 6 246 3.0E-07
sp|Q54L85|NSDHL_DICDI Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Dictyostelium discoideum GN=nsdhl PE=3 SV=1 4 174 6.0E-07
sp|Q56093|GALE_SALTI UDP-glucose 4-epimerase OS=Salmonella typhi GN=galE PE=3 SV=2 6 174 7.0E-07
sp|Q6DF08|UXS1_XENTR UDP-glucuronic acid decarboxylase 1 OS=Xenopus tropicalis GN=uxs1 PE=2 SV=1 4 202 8.0E-07
sp|Q5R885|UXS1_PONAB UDP-glucuronic acid decarboxylase 1 OS=Pongo abelii GN=UXS1 PE=2 SV=1 4 202 1.0E-06
sp|Q8NBZ7|UXS1_HUMAN UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens GN=UXS1 PE=1 SV=1 4 202 1.0E-06
sp|P09147|GALE_ECOLI UDP-glucose 4-epimerase OS=Escherichia coli (strain K12) GN=galE PE=1 SV=1 6 174 1.0E-06
sp|Q5PQX0|UXS1_RAT UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus GN=Uxs1 PE=1 SV=1 4 202 1.0E-06
sp|Q91XL3|UXS1_MOUSE UDP-glucuronic acid decarboxylase 1 OS=Mus musculus GN=Uxs1 PE=1 SV=1 4 202 1.0E-06
sp|Q5IFP1|3BHS_CANLF 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Canis lupus familiaris GN=HSD3B PE=2 SV=3 1 331 1.0E-06
sp|Q6K2E1|UGE4_ORYSJ UDP-glucose 4-epimerase 4 OS=Oryza sativa subsp. japonica GN=UGE-4 PE=2 SV=1 2 174 4.0E-06
sp|Q6GMI9|UXS1_DANRE UDP-glucuronic acid decarboxylase 1 OS=Danio rerio GN=uxs1 PE=2 SV=2 4 192 4.0E-06
sp|P55180|GALE_BACSU UDP-glucose 4-epimerase OS=Bacillus subtilis (strain 168) GN=galE PE=3 SV=1 6 174 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0009058 biosynthetic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0006629 lipid metabolic process No
GO:0008152 metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0016491 oxidoreductase activity No
GO:0016229 steroid dehydrogenase activity No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0008202 steroid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Peroxisomal targeting signal 0.1405 0.1897 0.2176 0.3804 0.5787 0.1279 0.1399 0.2948 0.1954 0.5472

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4789
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|679
Ophiocordyceps australis map64 (Brazil) OphauB2|4300
Ophiocordyceps subramaniannii Hirsu2|10245
Ophiocordyceps subramaniannii Hirsu2|10633 (this protein)
Ophiocordyceps subramaniannii Hirsu2|119
Ophiocordyceps subramaniannii Hirsu2|8006

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|10633
MTGKTVLVTGGSGFIGSHVIVHALQKGYHVRTTVRSLSRSDSVREKLLNGGISEEQARGVQFFEVDLLGDKGWDD
ACKGCDFVLHVASPYPLGVPKDEQEVIRPAREGTLRALRAAKRAGTVKRIVITSSFAAIGYGHEPRTKENPLTEK
DWTVLKSPKSPVGAYEKSKTLAEQDAWQWLKNEGSGMELATVNPVSVWGPSLGREENTSLELATRMLNGQLPGLP
NLAFGIVDVRDVADLHIKAMEAPEAAGQRYLAISDELSVSTSDISTYLKQGLPAHESRRVPTHVLPNFLLRLAGH
FDKSVALIVPELGIVRPTSNEKARRELSWKPRSARDAVISSPESLKRTGRVKL*
Coding >Hirsu2|10633
ATGACGGGAAAGACTGTCCTCGTTACGGGCGGGTCTGGTTTCATCGGCTCTCACGTCATCGTCCACGCGCTCCAG
AAAGGTTACCATGTCCGAACGACGGTGCGGTCTCTGAGCCGCTCCGACTCTGTGCGAGAAAAGCTCCTCAACGGC
GGCATATCCGAGGAACAGGCCCGCGGTGTCCAATTTTTCGAAGTTGACCTCCTGGGTGACAAGGGCTGGGACGAC
GCCTGCAAAGGCTGCGACTTTGTGCTCCACGTTGCGTCCCCCTATCCGCTGGGGGTGCCCAAAGACGAACAAGAG
GTCATCCGACCAGCCCGAGAAGGGACCCTCAGAGCATTGCGAGCCGCAAAAAGGGCGGGGACCGTCAAGCGGATC
GTCATCACATCGTCCTTCGCGGCCATCGGCTACGGCCACGAACCGAGGACCAAGGAAAACCCGCTGACCGAAAAG
GACTGGACTGTGCTCAAGAGCCCCAAGAGCCCGGTGGGGGCTTACGAGAAGAGCAAGACACTGGCCGAGCAAGAC
GCGTGGCAATGGCTCAAGAACGAGGGGTCGGGGATGGAGCTGGCGACGGTCAATCCCGTCAGCGTCTGGGGCCCT
TCCCTCGGCAGAGAAGAGAATACCAGTCTGGAGCTGGCGACGCGGATGCTGAACGGACAGCTTCCTGGCCTGCCC
AACCTCGCCTTCGGCATCGTCGACGTCAGGGATGTCGCCGACCTTCACATCAAGGCGATGGAGGCCCCCGAAGCT
GCCGGTCAGCGATACCTGGCCATCTCCGACGAGCTTTCGGTGTCGACAAGCGACATCTCGACGTACTTGAAGCAG
GGGCTCCCTGCACACGAGTCGAGGAGAGTGCCTACTCACGTGCTGCCGAACTTTCTCCTACGCCTCGCCGGGCAC
TTTGACAAGTCTGTTGCACTGATCGTGCCGGAGCTGGGAATCGTCAGGCCTACTAGCAATGAGAAAGCTCGGAGA
GAGCTGAGTTGGAAGCCTCGCAGCGCGCGAGATGCCGTCATCAGCAGCCCCGAGAGCTTGAAGAGGACGGGAAGG
GTCAAGCTCTAG
Transcript >Hirsu2|10633
ATGACGGGAAAGACTGTCCTCGTTACGGGCGGGTCTGGTTTCATCGGCTCTCACGTCATCGTCCACGCGCTCCAG
AAAGGTTACCATGTCCGAACGACGGTGCGGTCTCTGAGCCGCTCCGACTCTGTGCGAGAAAAGCTCCTCAACGGC
GGCATATCCGAGGAACAGGCCCGCGGTGTCCAATTTTTCGAAGTTGACCTCCTGGGTGACAAGGGCTGGGACGAC
GCCTGCAAAGGCTGCGACTTTGTGCTCCACGTTGCGTCCCCCTATCCGCTGGGGGTGCCCAAAGACGAACAAGAG
GTCATCCGACCAGCCCGAGAAGGGACCCTCAGAGCATTGCGAGCCGCAAAAAGGGCGGGGACCGTCAAGCGGATC
GTCATCACATCGTCCTTCGCGGCCATCGGCTACGGCCACGAACCGAGGACCAAGGAAAACCCGCTGACCGAAAAG
GACTGGACTGTGCTCAAGAGCCCCAAGAGCCCGGTGGGGGCTTACGAGAAGAGCAAGACACTGGCCGAGCAAGAC
GCGTGGCAATGGCTCAAGAACGAGGGGTCGGGGATGGAGCTGGCGACGGTCAATCCCGTCAGCGTCTGGGGCCCT
TCCCTCGGCAGAGAAGAGAATACCAGTCTGGAGCTGGCGACGCGGATGCTGAACGGACAGCTTCCTGGCCTGCCC
AACCTCGCCTTCGGCATCGTCGACGTCAGGGATGTCGCCGACCTTCACATCAAGGCGATGGAGGCCCCCGAAGCT
GCCGGTCAGCGATACCTGGCCATCTCCGACGAGCTTTCGGTGTCGACAAGCGACATCTCGACGTACTTGAAGCAG
GGGCTCCCTGCACACGAGTCGAGGAGAGTGCCTACTCACGTGCTGCCGAACTTTCTCCTACGCCTCGCCGGGCAC
TTTGACAAGTCTGTTGCACTGATCGTGCCGGAGCTGGGAATCGTCAGGCCTACTAGCAATGAGAAAGCTCGGAGA
GAGCTGAGTTGGAAGCCTCGCAGCGCGCGAGATGCCGTCATCAGCAGCCCCGAGAGCTTGAAGAGGACGGGAAGG
GTCAAGCTCTAG
Gene >Hirsu2|10633
ATGACGGGAAAGACTGTCCTCGTTACGGGCGGGTCTGGTTTCATCGGCTCTCACGTCATCGTCCACGCGCTCCAG
AAAGGTTACCATGTCCGAACGACGGTGCGGTCTCTGAGCCGCTCCGACTCTGTGCGAGAAAAGCTCCTCAACGGC
GGCATATCCGAGGAACAGGCCCGCGGTGTCCAATTTTTCGAAGTTGACCTCCTGGGTGACAAGGGCTGGGACGAC
GCCTGCAAAGGCTGCGACTTTGTGCTCCACGTTGCGTCCCCCTATCCGCTGGGGGTGCCCAAAGACGAACAAGAG
GTCATCCGACCAGCCCGAGAAGGGACCCTCAGAGCATTGCGAGCCGCAAAAAGGGCGGGGACCGTCAAGCGGATC
GTCATCACATCGTCCTTCGCGGCCATCGGCTACGGCCACGAACCGAGGACCAAGGAAAACCCGCTGACCGAAAAG
GACTGGACTGTGCTCAAGAGCCCCAAGAGCCCGGTGGGGGCTTACGAGAAGAGCAAGACACTGGCCGAGCAAGAC
GCGTGGCAATGGCTCAAGAACGAGGGGTCGGGGATGGAGCTGGCGACGGTCAATCCCGTCAGCGTCTGGGGCCCT
TCCCTCGGCAGAGAAGAGAATACCAGTCTGGAGCTGGCGACGCGGATGCTGAACGGACAGCTTCCTGGCCTGCCC
AACCTCGCCTTCGGCATCGTCGACGTCAGGGATGTCGCCGACCTTCACATCAAGGCGATGGAGGCCCCCGAAGCT
GCCGGTCAGCGATACCTGGCCATCTCCGACGAGCTTTCGGTGTCGACAAGCGACATCTCGACGTACTTGAAGCAG
GGGCTCCCTGCACACGAGTCGAGGAGAGTGCCTACTCACGTGCTGCCGAACTTTCTCCTACGCCTCGCCGGGCAC
TTTGACAAGTCTGTTGCACTGATCGTGCCGGAGCTGGGAATCGTCAGGCCTACTAGCAATGAGAAAGCTCGGAGA
GAGCTGAGTTGGAAGCCTCGCAGCGCGCGAGATGCCGTCATCAGCAGCCCCGAGAGCTTGAAGAGGACGGGAAGG
GTCAAGCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail